KEGG   Synechococcus sp. PCC 7502: Syn7502_01019Help
Entry
Syn7502_01019     CDS       T02371                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
synp  Synechococcus sp. PCC 7502
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:synp00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1030445..1031641
Genome map
AA seq 398 aa AA seqDB search
MTPLTWTELEALTDFQIDTTNGNTNSQSRLRLFGQSESDVRVTLFRDHHAWCPYCQKVWL
WLEEKQIPYRIEKVTMFCYGEKESWYKHKVPSGMLPAIELDGKIITESDEILIALERVFG
KLNHSMKDSLVMPLRKLERLLFRAWCNWLCYPITSERQDQTLRQQFKDVVAMVESALAKT
SGDYFLDQFGIVDVIFTPYVERMNASLYYYKGYSLRDENPYLSHWFNAMETRLTYRGTQS
DFHTHAHDLPPQMGGCYRNNEPQTLINQTKVDNGSWFELPDVKYPEPENARAEALYRVLK
HRHNIIRINPAENSLIDQALRCALTFMVTQEVCVPPQDSDLALRYLRDRISVPRDMCIYA
AKHLRESLEKTAALVGDRPSPPLPTSHRRDQDPANFRS
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgacacctctgacttggacagaactagaagccctcacagattttcaaatcgatactact
aacggcaataccaactcccaatctcgattacggctatttggacaatcagaatctgatgtg
cgggttaccctatttcgagatcatcatgcttggtgtccctattgtcaaaaagtttggcta
tggctagaggaaaagcaaatcccctatcgcattgaaaaagtgacaatgttttgctatggc
gaaaaggaaagttggtacaagcacaaagtcccttcgggaatgctgccagcgatcgagttg
gatggcaaaattattacggaaagtgatgaaattttgattgccctagaacgggtatttggc
aaactcaatcacagtatgaaagactccttggttatgcccttgagaaaattagagagactt
ctgtttagagcatggtgcaattggttatgttaccccataacttcagaacgtcaagatcaa
actcttcgtcagcaatttaaagatgtggtagcaatggttgaatctgctctagcaaagacc
tctggtgattattttctggatcagtttgggatcgtggatgtgatctttaccccatacgtt
gagcgtatgaatgccagtctttattactacaaaggctattccttgcgagatgaaaatccc
tatttatcccattggtttaatgccatggaaacccgccttacctacagaggtactcagagt
gattttcatacccatgcccatgatttaccgccgcaaatgggaggctgctataggaacaat
gagccgcaaacactgattaatcaaacaaaggtagataacggttcttggtttgagctaccc
gatgttaagtatccagaaccagagaatgcccgtgcggaggcactataccgagtcttgaag
caccgacataatattatccgtattaatcctgcggaaaatagcttaattgatcaagcatta
cgctgtgctttaacttttatggttactcaagaagtatgtgtaccacctcaggattctgat
ctagctctaagatatttgcgcgatcgcattagtgtgccacgggatatgtgtatttatgcg
gcaaaacatttacgggagtccttagaaaaaactgctgccttggtgggcgatcgcccttct
cctccgttaccaacctcccatcgtagggatcaagacccagcaaattttaggtcttga

DBGET integrated database retrieval system