KEGG   Synechococcus sp. PCC 7502: Syn7502_01550Help
Entry
Syn7502_01550     CDS       T02371                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
synp  Synechococcus sp. PCC 7502
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:synp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Syn7502_01550
Enzymes [BR:synp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Syn7502_01550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1548809..1550305)
Genome map
AA seq 498 aa AA seqDB search
MSFKRSSGILLHPTSLPSRFGIGDLGTSAYGFIDFLEASGQKLWQVLPLGPTGYGNSPYM
CFSAIAGSPMLISPDLLIKQELLWESDLESLPDFERDFTDFDRVIPYKTNIFRLAYDRFK
NRFITNENPEFTDFCANQSIWLDDYALFMAILETYEHKPWHTWEEAIAQREPEAIRHHTE
LLQEQISFHKFLQFQFFKQWAELRGYANQKEILIIGDIPIYVAHNSADVWANPSIFVLDP
ESFEPALMAGVPPDYFSETGQLWGNPVYNWEVLQQDNFSWWINRFKFMLQYVDIIRIDHF
RGFESFWQVPSGEDTAINGEWKLAPGQELFTTLRAVLGGLPILAEDLGIITPEVEALRDQ
FEFPGMRILLFAFGGDSNNIYLPHHYVKNSLVYTGTHDNDTAVGWWQRASEHEQELLTNY
VGVDEVKEINWLLIRLALASVSDLAVIPLQDIWGLDNTARMNMPGTATGNWAWRYSSNDL
LTSDLSDRLRNLTQLYSR
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcaaacgttccagtggaatcctgcttcaccccacctccttacctagtcgattt
ggaattggtgacctaggcacctctgcctatggatttatagattttctggaagcaagtgga
cagaagctttggcaggttttacccctaggacccactggttacggtaattctccctatatg
tgtttcagtgcgatcgctggcagccctatgttaattagtcccgatctattgatcaagcag
gaattactatgggaatcagatttggaatccttaccagattttgagcgagatttcacggat
tttgatcgagtaattccctataagactaatattttccgactggcgtatgatcgatttaaa
aatcgctttattactaatgaaaatcctgaatttacagatttctgtgcaaaccaaagtatc
tggctagatgactatgccctattcatggcaatcttggaaacctacgaacataagccttgg
catacctgggaggaggcgatcgcccaacgggaaccagaggcaatccgtcaccatactgaa
cttctccaagagcaaattagcttccataaatttttgcaattccagttttttaagcagtgg
gcagaattacgcggctatgccaatcaaaaggaaattttaattattggcgatattcccatt
tatgttgcacacaatagtgctgatgtctgggcaaatcctagtatctttgtccttgatcca
gaaagttttgaacctgcattaatggctggtgtgccaccggactattttagtgagacaggg
cagttatggggaaatccagtctataactgggaggtattgcaacaggataattttagctgg
tggattaatcgttttaagttcatgttgcagtatgtggatattattcgcatcgatcatttt
cgtgggtttgagtccttttggcaggtaccatcgggtgaagatacagccataaatggagaa
tggaaattggcaccagggcaggagctatttacgactttaagggcagttttaggtgggtta
ccaattttggcagaggatttaggaattatcacccctgaagttgaggcactcagggatcaa
tttgaatttccggggatgaggattttactgtttgcctttgggggcgactctaacaatatt
tatctcccccaccactatgttaaaaatagcttagtttatactggcacccatgataatgat
acggcagtgggttggtggcaacgtgcaagtgagcatgagcaagaattattgacaaattat
gttggagtagatgaggttaaggaaataaattggctattaattcgactagctttagcatcg
gtatctgatttggcggtgatccctttacaggatatttggggcttagataacacagcaagg
atgaatatgcccggcactgccacaggtaactgggcttggcgttatagttctaacgattta
ttaacttctgacttaagcgatcgcctccgcaatttaacgcagctatacagccgatag

DBGET integrated database retrieval system