KEGG   Synechococcus sp. PCC 7502: Syn7502_01799Help
Entry
Syn7502_01799     CDS       T02371                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
synp  Synechococcus sp. PCC 7502
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:synp00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation
Environmental Information Processing; Signal transduction; Two-component system [PATH:synp02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1791506..1795042)
Genome map
AA seq 1178 aa AA seqDB search
MDTNATLPKLSFIGQATYPAQSVNVKDANGNDTTVGGLSGITYDAKNNVFYSISDDRKSN
PNEPGQPTRFYNLKIDLSSGSLDNSKVSFQNVTLLKKADGTNYTPQSTDTEDIGLTNRGT
VFISSEGQVDAAGQIRTNPFVNEYNLSTGQLLRTLPIPTKFLPDTNLAATETRGTYDNLA
FESVAISPDKRTLLTATENALIQDGQRTSFPGSDALNPSGIGRSRLLKFNLDTNQAVGEY
LYNVDPTAVAPSKNPTNDTNNFSTAGLVALTALDNNGNYLAIERSFSSVPANTPNSPETS
NVIKIYRVSIGDADDISSINSLKALSDTDFAKIKPAQKQLLLNLDDLKLSTGLDNIEGVT
FGPTVNGKPTLVLVADDNFNKTPAANSTNNTFNQSQFTQIVALTVDFSGAFPNGVASGDT
TQTSTVLWTRTPILGNVTFEYSTSADFSTIAGTKTATVTNSLQPVKVGVDGLNPNTNYFY
RVTDALGDRATGQFSTAAASGTQTGLGFGISGDWRGELSPYPSISNADERNLKFFVEFGD
TIYGDVASPGLKNADGTEKQQATSIDDYRAKYAEVYGSRYGQNTFADLRASTSILATIDD
HEVTNDFAGAAPISSDKGGAGGTNRFLAAFPSDNPNTLINDSTLFENGLQAFQDYKPVQD
QFYGQTGDTKTAGERKLYRANTYGSDAINIVLDARSFRSQELDGVVNPADTAAIGAFLTK
SFDPTRTLLGRAQVDDLKRDLLQAQKDGVTWKFIDIPEPIENLGVLAASDRYEGYAAERT
EILKFINDNKITNVVFVSADIHGTLVNNLTYQEGVGKPQIATSAFEVVTGSVAYDAPFGP
TVAELALAAGLITAPQKALYDSFPNAGKDAFIKNIVNGGLTPLGYDPVGLDNNLSQANGL
INAKLLKGDYVATNTYGWTEFNIDPTTQKLTVTTWGIDAYTRAQLEANPSAFTSLQPQIV
SQFEVTPNAVVADSKLTSIGTSGNDDLIATNGGVFDGRSNIAFTGAGDDTVDLQFNTSFA
VGNSRIDTGSNNDTIFVTQGDRVFGSAGNDTFEATDAKGGNRMSGGTGDDTFFLGFGDRA
LGGDGNDKFFVGTGGNNLLSGGAGADQFWIFNVSAPTAANTIVDFQAGTDVIGINGGGIL
SFANLTLTGNSIIIGNNAIATLTGVDTSSLTASNFVFQ
NT seq 3537 nt NT seq  +upstreamnt  +downstreamnt
atggatactaatgcaactctgccgaagttgagctttattggtcaagcaacctatcccgcg
caatcagtaaatgttaaagatgccaatggcaacgatactactgtaggtggtttgtctggc
attacctacgatgccaaaaacaatgttttctatagcatttctgatgatcgcaagagcaat
cccaacgaacccggtcaacctacccgtttttacaatctcaaaattgatttaagttcagga
agtttagataacagtaaagtttcgttccaaaatgtcacgctcttaaagaaagcggatgga
actaattacacgcctcaaagcactgatactgaagacattggcttgactaatcgcggtaca
gtatttatctcctctgaagggcaagtagatgcggctggacagattcgtactaatcccttt
gtgaatgagtacaatctctcaacaggacaattgttgagaacattgccaattcccactaag
tttctgccagatactaatctagccgccactgaaaccagaggaacttacgacaacctcgcc
tttgaaagcgtggcaattagtcccgataagcgtaccttgctgactgctacggaaaatgct
cttattcaagacggtcagcgtactagcttcccaggttccgatgctttgaatccatctggt
attggacgatcgcgcttactgaagttcaatttagacaccaaccaagctgtcggtgagtat
ctgtataacgttgatcccacggcagttgcgccttctaagaatcctacaaatgacactaac
aatttcagcacggcaggattggtggcgctcacggctctagacaataacggtaactactta
gctatagagcgatcgttctcttctgtgccagcgaatacgcctaatagtccagagacaagt
aatgttatcaaaatttatcgagtcagcattggcgatgcggacgatatcagcagcatcaat
agcttaaaggctctttccgataccgattttgccaagatcaagcccgcacaaaaacaactg
ttgttgaatttggacgatctgaagttgtctacaggacttgataatatcgaaggcgtaacc
tttggtccaacggtaaatgggaagccaacgcttgtcttagtagctgatgacaatttcaac
aaaactcccgccgcaaattcgacaaataacacctttaaccagtcgcagtttactcaaatt
gtggcacttacggttgatttctctggtgcattccctaatggtgttgcttctggcgatact
acacaaacttccacagttctttggacacgcacgccgattctcggtaacgtcacttttgaa
tattccacaagtgccgattttagtacgatcgctggtacgaaaacggctaccgttaccaac
tccctgcaacccgtaaaggttggtgtcgatggcttgaatccaaacacgaattatttctat
cgagttaccgatgcattaggcgatcgcgctactggtcaattcagcacagcggcagcaagt
ggaactcagacaggtttgggctttggtatttctggcgattggcgtggtgaactcagcccc
tatccttccatctctaatgctgacgaacgcaatctcaaattctttgtagaatttggcgat
accatttacggtgatgttgcatcccctgggctaaagaatgcagatggtactgagaagcaa
caagctacatccatagatgactaccgcgcaaaatatgccgaagtatatggaagtcgctac
ggtcaaaatacttttgccgatcttcgcgcttcaacttccattttggctactatcgacgat
cacgaagttaccaatgactttgcaggtgcggctcctattagtagcgataagggtggcgct
ggcggaactaatcgatttttagcagctttcccaagcgacaatcctaatactctgattaat
gacagtacgctttttgagaatggcttacaagctttccaagattacaaaccagtccaagac
cagttctacggacaaactggcgacaccaaaactgctggcgaacgcaaactctatcgggca
aatacttacggtagcgatgcaatcaatatcgttttagatgctcgttctttccgcagtcag
gagcttgatggtgtcgttaatcctgctgacactgctgcaattggggctttcttaactaag
tccttcgatcctacgcgcaccctcctaggtcgcgctcaggttgatgacctcaagcgcgat
cttttacaagctcaaaaggatggagtaacttggaagttcatcgatattcccgaaccaatt
gagaatttgggtgtgcttgctgcgagcgatcgctatgaaggttatgccgctgagcggacg
gaaatcctcaaattcatcaatgacaacaaaattactaacgtagtcttcgtttccgccgat
attcacggcacattggtaaataaccttacctatcaagaaggagttggcaaacctcaaatt
gctactagtgcttttgaagttgttactggttcagttgcctatgatgcaccattcggtcct
actgtagctgagctagctcttgcggctggattaatcacagctccgcaaaaggctttatat
gattccttccctaatgctggtaaggatgccttcatcaagaatattgtcaatggtggcttg
actccattgggttacgatcctgtgggtctagataacaatctctctcaagcaaatggatta
attaatgccaagttattgaagggagattatgttgccaccaatacctatggctggactgag
tttaatatcgatcccaccacacagaagttgaccgtcacaacgtggggtattgatgcctat
acccgcgctcagttggaagcaaatcccagcgcctttacttccctgcaaccgcaaattgtc
agtcagtttgaagtcacacccaatgcggttgtggcggatagtaaattgactagtatcgga
acatcaggtaatgacgatttgattgccaccaatggcggtgtgtttgatggtcgtagcaac
atcgcgttcacaggtgcaggtgatgacactgtcgatctgcaatttaacacttcgtttgca
gttggcaatagtcgtattgacactggcagcaacaacgacacaatcttcgtcactcagggc
gatcgcgtatttggtagtgctggcaacgatacttttgaagctactgatgccaaaggcggc
aaccgcatgtctggtggtactggcgatgacactttcttcttaggatttggagatcgcgct
ctgggtggtgacggtaatgacaaattctttgttggtactggtggcaataacttgttatct
ggtggtgctggtgctgaccaattttggattttcaatgtttctgctcccactgctgcaaat
accattgttgatttccaagcgggaacagatgtcattggcatcaatggcggaggaatactc
agctttgccaatttgactctcactggtaatagcatcattattggaaataatgcgattgcg
accttaactggagttgatacttcttctttaactgcttctaacttcgtatttcagtaa

DBGET integrated database retrieval system