KEGG   Synechococcus sp. PCC 7502: Syn7502_01826Help
Entry
Syn7502_01826     CDS       T02371                                 

Definition
magnesium chelatase subunit H
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
synp  Synechococcus sp. PCC 7502
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:synp00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1829612..1833577
Genome map
AA seq 1321 aa AA seqDB search
MLTSVKPTTRHIAPNLQNDNRALMKVVYVVLEPQYQSALSGAIASINKNNPSLVIEVNGY
LIEELRQPEAYEAFKADVATANIFIGSLIFIEDLANKVVDAVAPHRDRLDVCIVFPSMPQ
VMRLNKMGSFSMENLGQSKSAIAQFMRKRKEKSGSSFQDSMLKVVQTLPKILKYMPMDKA
QDARNFMLSFQYWLGGSEENIKNFLLMLAKNYLPAGSKSITVADPVTYLDMGIWHPMAPK
MFDDINEYLNWFNARRDISADIKDPLAPCIGLVCARSHIVTGDDAHYVAVVQEMESKGAR
VIPVFAGGLDFSKPVDAYFYGKDGKCLVDSVVSLTGFALVGGPARQDHPKAVAALEKLNR
PYMVALPLVFQSTEEWQDSDLGLHPVQVALQVALPELDGAMDPIVMSGRDEMTGRAIALS
DRVEMIANRAIKWGTLRRKPRLEKKIAITIFSFPPDKGNIGTAAYLDVFASIHKVIKALA
GNGYDVQDIPADANALMQDILHNPNAMAGSPELNIAAKLSVRDYEENTPYCDRITEQWGA
PPGHLNSDGQSLLIYGKHYGNVFVGVQPTFGYEGDPMRLLFSKSASPHHGFAAYYTYLNQ
IWKADAVLHFGTHGSLEFMPGKQIGLSGECYPDNLIGALPNIYYYAVNNPSEATIAKRRG
YATTISYLTPAPENAGLHRGLKELSELIGSYKELRLGNRGVSIVNTIMDKVRLVNLDQDV
DLGDLDAKDMSLEERDNIVGQVYNKLMEVESRVLPCGLHVVGEAPKLEDITDVLSSIASF
DRPEDNVKSLLRIIAESIGRDLEQIYKSSDKGNYADVELLATMKATTNKAVGALVKAKAD
VDGRISKLSVLNFLNMGKVEPWIESLKSSGYEKVNKDEIKPLFEFLEFCLKQIIADNELG
GLIKALEGEYILPSPGGDPIRNPNVLPTGKNMHALDPQSIPTSAAVQAAQVVVERLLERQ
KADNNGNYPETIALVLWGTDNIKTYGESLAQVLWMVGVKPLPDALGRVNRLELVSLEELG
RPRIDVVVNCSGVFRDLFINQMDLLDRAVRMAAEADEPLEMNFVRKHAIAQAEELGISTR
QAATRVFSNASGSYSSNVNLAVENSTWEKEEELQEMYLARKSFAFGSEVSNTQQRQIYES
ALKSVDVTFQNLDSSEISLTDVSHYFDSDPTKLVASLRKDGKQPSAYMADTTTANAQVRT
LSETVRLDSRTKLLNPKWYEGMLNHGYEGVREISKRLVNTMGWSATAGAVDNWVYEDVND
VYVKDAEMRDRLKNMNPHSFRKIVGTLLEVNGRGYWETSDQNLEMLRDLYQELEDRIEGV
E
NT seq 3966 nt NT seq  +upstreamnt  +downstreamnt
atgctcacttctgtgaaacctacgaccagacacattgcccccaatttacaaaacgataat
cgggcacttatgaaagtcgtctatgttgtattagaaccacaatatcaaagtgctttgagt
ggagcgatcgcctcaattaataaaaataatcctagcctagtgattgaagtcaatggctat
ttaattgaagaattacgccaacctgaggcttatgaggcatttaaggctgatgttgccact
gccaatatatttatcggttcgttaatttttatcgaggatttagcaaataaagttgtagat
gccgttgcccctcaccgcgatcgccttgatgtttgtatcgttttcccttctatgccccag
gtcatgcgcctgaataaaatgggtagctttagtatggaaaatttagggcagtccaaaagt
gcgatcgcccagttcatgcgtaagcgtaaagagaaatcgggtagctccttccaagacagc
atgctcaaggttgtccagactctacccaagattctcaaatatatgccgatggataaggcg
caggatgctcgtaactttatgttgagctttcagtactggctgggtggatcggaagagaat
attaaaaacttcctattaatgctggcaaagaattatctccctgctggttctaaatccatc
actgtagccgatcctgtcacctatttagatatgggaatttggcatcctatggctccaaaa
atgtttgacgacattaatgaatatctaaactggttcaatgcccgtcgggatatttctgcg
gatattaaagaccccttagcaccttgcatcggtttggtttgcgcccgtagccatattgtc
actggagatgacgcccattatgtggcagtggttcaagaaatggaatcaaaaggagctaga
gtaattcccgtatttgcaggcggcttagacttctctaaaccagtggatgcctatttctac
ggcaaagatggcaagtgcctagtcgatagtgtagtctcacttacaggttttgcgctcgtg
ggcggacccgcacggcaggatcatcctaaggcagttgctgccctggaaaaattaaaccgt
ccctacatggtggcgttacccctcgtcttccaaagcactgaagaatggcaagatagtgat
ttgggcttacatcctgtgcaagtggctttacaggttgctcttcctgaactagatggagct
atggatccaattgtcatgtctgggcgggatgaaatgacaggcagagcgatcgccctatca
gatcgggtagaaatgattgctaatcgtgccattaagtggggaaccctacgccgcaagcct
agattagagaaaaagattgcaattacgatttttagcttccccccagacaagggcaatatt
ggcacagccgcctacttagatgtatttgcctccatccataaagtaatcaaggctctagca
ggtaacggttatgacgtgcaagatattcccgccgatgccaatgccttaatgcaggatatt
ctccataatcccaatgccatggctggtagccccgaattaaatattgccgccaagctttct
gttcgtgattatgaagaaaatactccctattgcgatcgcattaccgaacaatggggcgca
cctccagggcatcttaactccgatgggcagagccttttgatctacggtaagcattacggc
aatgtatttgtcggtgtgcaacccacctttggctacgaaggcgatcccatgcgcttactt
ttcagtaaatcagcttcaccccaccacggatttgcagcttactacacctatctcaatcaa
atttggaaggctgatgcggttctacactttggtacccatggatcgctggaattcatgcct
ggcaagcagattgggctttcaggtgaatgctatcccgataacttaattggagccttaccc
aatatctattactacgctgttaataatccttccgaagcgacgatcgccaagcgcagaggt
tatgccactaccatcagttatctcactcctgctcccgaaaatgcaggcttacaccgaggc
ttaaaggaactgagcgaattaattggctcctataaggaactacgtctaggtaatcgtggg
gtttccatcgtcaatacgattatggataaggtacggttagtaaatctcgatcaagatgtg
gatttaggcgatctagatgctaaggatatgagcctcgaagaacgtgacaacattgtcggt
caggtttataacaaactaatggaagtggaatcaagggttctaccttgtggactgcacgtt
gtcggtgaagctccaaaacttgaagatattacggatgtgctttccagcattgccagtttt
gatcgccctgaagataatgtcaaatctctattacggattattgccgaaagtattggacga
gatttagaacaaatctataaatccagtgataaaggcaactatgctgatgtggaactgtta
gcaacaatgaaagctacaaccaataaggcagtgggagcattagtcaaagctaaagctgat
gtggacgggcgcatttccaagctatcagtgctgaacttcctgaatatgggtaaagtggag
ccttggattgaatctttaaaatcctcaggttatgaaaaagtcaataaggatgaaatcaag
cccttatttgaatttttagaattttgcttgaaacaaatcattgctgataatgaacttggt
ggcttgattaaggctttagaaggtgaatatatcctgcctagtcctggtggcgatcccatc
cgaaatcccaacgtgctgcctacgggtaaaaatatgcacgcccttgatcctcagtcaatt
cccaccagtgctgcggtacaagctgctcaagtcgtagtggaaagactactggaacgccaa
aaagctgataacaatggcaattacccggaaacgatcgccctagtactttgggggactgat
aatatcaaaacctatggtgaatccttagcacaagtgctgtggatggtgggggtcaagcct
ttgcctgatgcccttggtcgtgtgaatagattggaattagtttccttagaagaattaggt
cgccctcgtattgatgttgtcgttaattgctcaggcgtattccgtgatttattcatcaat
caaatggatttactagatcgggctgtgagaatggcagcagaagctgatgaaccccttgag
atgaattttgttcgtaagcatgcgatcgcccaagcagaagaactaggaattagtacccgt
caagcggcaactagggtatttagtaatgcttcgggttcctattcatctaatgtcaacctt
gctgtagagaatagcacttgggaaaaggaagaagaactacaagagatgtatctagctcgt
aagtccttcgccttcggttctgaggttagcaatacccaacaacgccaaatctatgagtcg
gcactcaagtctgtagatgtcactttccaaaaccttgactcttcggaaattagtttaacc
gatgtctcgcactactttgattcggatccaaccaagcttgtagctagtctgcgtaaggat
ggtaagcaacccagtgcttacatggcagatacgactacggcgaatgctcaagtgcgaact
ctttctgaaactgtgcgtttagattcccgaactaagctgctcaatcccaagtggtacgaa
ggcatgctcaatcatggctacgaaggagtcagagaaatctccaaacgccttgttaatact
atgggttggtcggcaacggctggtgctgtagataactgggtctatgaagatgtcaatgat
gtctatgttaaagatgcggaaatgcgcgatcgcctcaaaaacatgaatcctcactctttc
cgtaagattgttggcactctattagaagtgaacggtagaggttattgggaaaccagtgac
caaaacttggaaatgctgcgtgacttgtatcaagagctggaagaccgtattgaaggtgta
gagtaa

DBGET integrated database retrieval system