KEGG   Synechococcus sp. PCC 7502: Syn7502_02166Help
Entry
Syn7502_02166     CDS       T02371                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
synp  Synechococcus sp. PCC 7502
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:synp00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Syn7502_02166
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Syn7502_02166
Enzymes [BR:synp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Syn7502_02166
Two-component system [BR:synp02022]
 CheA family
  CheA-CheYBV
   Syn7502_02166
Bacterial motility proteins [BR:synp02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Syn7502_02166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2170136..2171242
Genome map
AA seq 368 aa AA seqDB search
MIPVNVLLVEDSPIALEILQRILSTSPDIQVVGVAHNGKQALDLIPTVKPDVICVDMFME
RMDGLELIRQVMAKFPCPILVVSNAVQSSDTDNIFRLLQAGAVDVFPKPATGLPSDYEKV
KAALINKIKVLSGVRVFTRPLKDLEPPKPAIASVIQSQIQSPLPVIPLVDPIAALKSQFK
VLAIGASTGGPSAFEKILYRFPANFPMPIICAQHISEGFLAGLVTWLDTNCALKVKIAQV
GELPQPGIIYFAPETHHLELDNKGKFIYAVSSQTRAYRPSITMLFQSIARFYGKTCMAAL
LTGMGNDGAEGLKTIFDHGGLTIAQDESSSVIFGMPKEAIALGAARYILPLQDIAPFLIT
QAVSSRSN
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgattccagttaatgtgctccttgttgaagactcacccattgcccttgaaattctccag
aggatacttagtacttctcccgatattcaggtggttggggtggctcacaatggcaaacaa
gcccttgatttaattcccactgtgaagcctgatgtgatttgtgtggatatgtttatggag
agaatggatggactggagttgatccgtcaggtgatggctaaatttccttgtccgattcta
gttgttagtaatgcggtgcagagttcagatacagataacatttttcggttattacaggct
ggagccgttgatgtttttcccaagccagctacgggtttaccatcggactatgaaaaagtt
aaagctgcactgattaataaaattaaagttttatctggggtgagagtatttaccagacca
cttaaagatttagaaccgcctaaacctgcgatcgcttcggtaattcagtctcaaattcaa
tcacccttgcccgtaatacctttagttgatccaatcgcagctttgaagtctcaatttaaa
gtgttagcgatcggggcatcgacgggtggtcctagtgcgtttgaaaagattctttatcgc
tttcccgctaatttccccatgcccataatttgcgctcaacatattagtgaaggcttttta
gcaggactagtaacttggctagatactaattgtgctctcaaagttaaaatcgctcaagtt
ggagaattgccacaaccggggattatttactttgcccccgaaacccatcacctagaactg
gataataaaggtaaatttatctatgccgtgagtagccaaactagagcctatcgtccatcc
attacgatgttgtttcaatcgatcgctagattctatggcaaaacctgtatggcagcactg
ctaacaggtatgggtaatgacggggcagaaggactaaaaactatttttgatcatggtggg
ttaacgatcgcccaagatgaaagtagtagtgtgatttttggtatgcccaaggaagcgatc
gctctcggtgcagctcgatatattttacctttacaagatattgcgccatttttaataact
caagctgttagtagtcgttccaattaa

DBGET integrated database retrieval system