KEGG   Synechococcus sp. PCC 7502: Syn7502_02364Help
Entry
Syn7502_02364     CDS       T02371                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
synp  Synechococcus sp. PCC 7502
Pathway
synp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
synp01100  Metabolic pathways
synp01110  Biosynthesis of secondary metabolites
synp01130  Biosynthesis of antibiotics
synp01230  Biosynthesis of amino acids
Module
synp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:synp00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Syn7502_02364
Enzymes [BR:synp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Syn7502_02364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS ThiG NMO PIG-X GGGtGRT DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: AFY74351
UniProt: K9SWR0
Position
complement(2354881..2355771)
Genome map
AA seq 296 aa AA seqDB search
MQIRRLNFTTSADYAIAPSNSSPQNILEKIVWHKEHEVILAKSSFAIDAAISYLKFAPRI
RNFRETLKLKHQKNQLALIAEVKKASPSKGIIRSDFDPVAIAQAYERGGASCLSVLTDQE
FFQGGFNNLHLIRHSVDLPLLCKEFIIDPYQIYIARLHGADAILLITAILSDQDLENFSA
IAQNLGMSVLIEVHTHSELERVLELPNVDLVGINNRNLETFTVDITNTKNLLEAIAIKKK
SDQKSNILWVSESGLYTNQDLQLVKAYGANAVLVGESLVKQEDVEAATKLLLKNEC
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattcgccgcttaaatttcactacctctgccgattatgcgatcgccccttccaat
tcttcgcctcagaacattctggaaaagatcgtttggcataaagagcatgaggtaatttta
gccaagtcaagttttgccatagatgcagcgattagttatctcaagtttgccccacgtatt
agaaacttcagagagacactaaaacttaagcatcagaaaaatcaacttgctctcattgct
gaggttaaaaaagcttcccccagtaagggcattataagaagtgattttgatccagtagcg
atcgcccaagcatacgaacgaggaggagccagttgtttatcggtattaacggatcaagaa
tttttccaaggtggttttaataatttgcacctaattcgccactctgttgatctgccgtta
ttgtgtaaagaatttattatcgatccctatcaaatttatattgctcgcttacatggtgcc
gatgccattttattaattacagcaattttgagcgatcaggatttagaaaatttcagtgcg
atcgcccaaaatttgggaatgtctgtattaatagaggtacatactcattccgaactagaa
cgagtgcttgaacttccgaatgtggatttagtcggcattaataatcgtaatttagaaact
tttaccgtagatattactaatactaaaaacctgttggaagcgatcgccataaagaaaaag
tccgatcaaaaatctaacattctatgggtaagtgagtctggactttataccaatcaggat
ttgcaattagtcaaagcctacggtgctaatgcagttttagtaggagaatccttagtcaag
caagaggatgtagaagcagcaacaaaattacttttgaaaaacgaatgctga

DBGET integrated database retrieval system