KEGG   Synechococcus sp. PCC 7502: Syn7502_02581Help
Entry
Syn7502_02581     CDS       T02371                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
synp  Synechococcus sp. PCC 7502
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:synp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Syn7502_02581
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Syn7502_02581
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Syn7502_02581
Enzymes [BR:synp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Syn7502_02581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2551927..2553228)
Genome map
AA seq 433 aa AA seqDB search
MTSIINSPASVTQTFSHLKCKECGSKYEPKAMHVCEMCFGPLEVDYDYAAIASKVSRETI
AAGPNSIWRYRHFLPVQTDNYIDVGTGMTPLLKANRLARRLGIKNLYIKNDAVNMPTLSF
KDRVVSVALSRARELGFSTVACASTGNLANSTAAIAAHAGLDCCVFIPADLEAGKVLGTV
VYAPKVFAVQGNYDQVNRLCSEVANTHGWGFVNINLRPYYSEGSKTLGYEVAEQLGWQLP
DHIVAPLASGSLFTKIYKGFQEFVKVGLVDDKPVRFSGAQADGCSPIATAFREGRDFVTP
VKPKTIAKSIAIGNPADGVYALDIARKTNGNIESVTDAEIIEAMKLLAETEGIFTETAGG
TTIAVLKKLVEAGKIDPDEVTVVYITGNGLKTQEAIQGYVGEPLQIEPKLDSFERALERS
ITLERLEWQEVSV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacatccatcatcaattcccctgctagtgttacgcagacgttcagtcatctcaagtgt
aaagaatgtgggtctaagtatgaacctaaagccatgcatgtatgtgaaatgtgttttggt
cccctagaagttgattatgactatgcagcgatcgcttctaaggtaagtcgagaaaccatt
gcggctggaccaaattcgatctggcgttatcgtcattttttacctgtccaaactgacaac
tatatagatgtcggaacgggtatgacccctttattaaaggctaatcgcttggcacgaaga
ctaggtatcaaaaatctctacatcaaaaatgatgccgtcaatatgcctactctaagcttt
aaagatcgggtagtatctgtggctttaagccgtgcccgtgagctagggtttagtacagtt
gcctgtgctagtacaggaaatttggctaactcaacggcggcgatcgctgcccatgctggt
ttagattgttgtgtatttattcctgcagatttagaagcaggcaaagtattgggtactgta
gtttatgcccccaaggtttttgccgtgcaaggtaactatgaccaagttaatcgcctctgt
tccgaagttgctaacacccacggttggggatttgtaaatattaatctgcgtccttactac
tcagagggttctaaaaccttgggctatgaagtagcggagcagttgggatggcagttaccc
gatcacattgttgcgcctttggcatctggttcattgtttaccaaaatctataagggtttc
caagagtttgttaaagttggcttagtagatgataaacccgttagattcagtggtgcccaa
gctgatggttgttctcccattgctacagctttccgtgaaggacgggattttgttacccct
gtgaagcctaagaccattgccaagagcattgcgatcggcaatcctgcggatggagtttat
gccctagatattgcccgcaaaactaacggtaatattgagtcggtcactgatgccgaaatt
attgaagcaatgaaattactagccgaaaccgaaggcatattcactgaaactgctgggggt
acgacgatcgctgtacttaagaaacttgtggaagcaggtaaaatcgatcccgatgaagtt
acagttgtctatattacgggcaatggcttaaaaacccaagaagcaattcaaggttacgtc
ggcgagcctttacaaattgaacctaaactagatagctttgaacgggctttggaacgctcc
attaccctagaaaggttagagtggcaggaagtgtctgtttag

DBGET integrated database retrieval system