KEGG   Synechococcus sp. PCC 7502: Syn7502_02944Help
Entry
Syn7502_02944     CDS       T02371                                 

Definition
fatty-acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
synp  Synechococcus sp. PCC 7502
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:synp01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:synp01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2889276..2890172)
Genome map
AA seq 298 aa AA seqDB search
MTTTSLNSNQKPTNQPDNQESLQLNWTTTIFYVVMHAIALLGFGYFSWQALGLTIFLHWL
TGSIGICLGYHRLLSHRSFQVPKWLEYIFATLGALALQGGPVFWVGGHRQHHGFTEDNDK
DPYSASKGFWWSHLAWILYSKKEHFDFKNYYSFAPDLGSDTYYRFLDKYFLSLQIPLGIL
LYFIGATQGQGIGFVIYGIFVRAVLVSHSTWFINSACHKWGYRNFGDSDDHSTNLWWAAL
VTYGEGWHNNHHAYPKSARAGLNWWEIDPTWGAIWLLRAVGLAKKVYIPAPWLPAGLK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaacctctttaaattcaaatcaaaagccgactaaccaaccagataatcaagag
tctttacaacttaattggacaactacaattttctatgttgtcatgcatgcgatcgctctt
ttagggtttggctatttttcttggcaagcactaggtttaacaatatttttgcattggctt
acgggcagcatcggtatttgtcttggttatcatcggctcttgagtcatcggagttttcag
gtacccaaatggctagagtatatttttgccacccttggagctttggctttgcaaggtggt
cctgtattttgggtggggggacatcggcagcatcacgggtttactgaagataatgacaaa
gacccctattctgccagcaaaggattttggtggagtcacttagcttggattttatattct
aaaaaagaacattttgattttaagaattactatagctttgccccagacctaggttctgac
acctactatcgctttttagataaatattttttaagtttacaaattcccctaggcatcctg
ctctattttattggagctacccaaggacagggtattggctttgtaatttatggcattttt
gtcagggctgtattagtttctcacagcacttggtttattaactccgcctgtcataaatgg
ggctaccgtaactttggtgatagtgacgatcattccaccaatctttggtgggcagcatta
gtaacctacggtgaaggctggcataataatcaccatgcctatccgaaatccgcaagggct
ggcttaaattggtgggaaattgatccaacttggggtgcgatctggttattacgagccgtg
ggattagcgaaaaaagtttatatccctgcaccttggctacctgcggggcttaaataa

DBGET integrated database retrieval system