KEGG   Synechococcus sp. PCC 7502: Syn7502_02949Help
Entry
Syn7502_02949     CDS       T02371                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
synp  Synechococcus sp. PCC 7502
Brite
Enzymes [BR:synp01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     Syn7502_02949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2894971..2895672
Genome map
AA seq 233 aa AA seqDB search
MIELYYWTTPNGHKVTIFLEEAKLEYKIFPVDIRTGEQFKAEFLEISPNNRIPAIIDRSP
NQGAEPISIFESGAILLYLAEKTRKFLPTTLGDRTKVLEWLFWQMGGLGPMAGQNHHFSQ
YAPEKIPYAITRYVNETNRLYGVLNRQLENREYIAGSYSIADMACYPWIVPYERQQQNLD
DFPNLKRWFETMAGRSAVIKAYQVAEKYKTTTVTEDSKNILFGQTAESIKPRK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgattgaactgtactactggactacaccaaacgggcataaggttacgattttcttagaa
gaagctaaattagaatataaaatttttcccgtagatattagaacaggagaacaatttaag
gcggagtttctggaaatttctcctaataatcggattcctgccattattgaccgatcacct
aaccagggggcggagccaatatccatatttgaatctggggcaatattactatacttagcc
gaaaagacaagaaaatttttaccaacgactctgggcgatcgcactaaggttttagagtgg
ctattttggcaaatgggcggattgggaccaatggcgggacaaaatcatcattttagtcag
tacgccccagaaaaaattccctatgcaattacccgttatgtcaacgaaactaatcgttta
tatggggttttaaatcggcagttagaaaatcgggaatatatagcaggttcctactctatt
gctgatatggcttgctatccgtggattgtcccctatgaacgtcaacaacaaaacctggat
gactttcccaacttaaagcggtggtttgaaactatggcagggcgatcggctgtaattaag
gcttatcaggtggcagaaaaatataaaaccacaaccgtaactgaagacagcaaaaacatt
ttatttgggcaaacggctgaatcaattaaacctagaaaataa

DBGET integrated database retrieval system