KEGG   Synechococcus sp. PCC 7502: Syn7502_03116Help
Entry
Syn7502_03116     CDS       T02371                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
synp  Synechococcus sp. PCC 7502
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:synp00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3060916..3061683
Genome map
AA seq 255 aa AA seqDB search
MTTSPTRSPAVKNTDKDSKNDNNILSISAKKPISHTIRERLEIAGAPYLANDSIADHLSD
AEREELKLEIEGKLQSLFDSMIIDTKNDHNTRETAHRVAKMYVDEVFKGRYHPMPKVTDF
PNAKELDEIYTLGPITVRSACSHHFVPIVGQAWVGILPSDRVIGISKFNRIIDWVLSRPH
IQEEAAVMVADIIEDLIKPKGIAFVIKAQHMCMSWRGVKEPETRMVNSVVRGAFRADPYL
KKEFFDLIRSQGFGE
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgacaacatctccaactcgatcgcctgctgtcaagaatactgataaagactctaaaaat
gataataatattctatcaatcagtgccaaaaaaccaatttctcacactattagggaaaga
ctagagattgcaggtgcgccataccttgccaatgattctattgctgatcatttatcagat
gcggagcgagaagagttaaagctagagattgaaggtaagttgcagagcctatttgactcc
atgatcatagatacaaaaaatgatcacaatacccgtgaaactgcccatcgtgttgccaag
atgtatgtggatgaagtatttaagggacgttatcaccccatgcccaaggttacagatttt
cctaatgccaaagaattagatgaaatttataccctcggtccaattacagtgaggtctgcc
tgttctcatcattttgtgccgattgttgggcaagcttgggtgggaattttacctagcgat
cgcgttattggcatttctaagtttaatcgcattattgattgggtgctgagtcgtccccat
atccaagaagaagctgcagttatggttgcagatattattgaagacctaattaagcccaag
ggtatagcgtttgtgattaaggcacaacatatgtgtatgagttggcgtggggttaaagaa
ccagaaactcggatggttaactcggtagttagaggggcatttagggctgatccctacctc
aaaaaagaattctttgacctaattcgttcccaaggttttggcgaatag

DBGET integrated database retrieval system