KEGG   Synechococcus sp. PCC 7502: Syn7502_03422Help
Entry
Syn7502_03422     CDS       T02371                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
synp  Synechococcus sp. PCC 7502
Pathway
synp00260  Glycine, serine and threonine metabolism
synp00750  Vitamin B6 metabolism
synp01100  Metabolic pathways
synp01110  Biosynthesis of secondary metabolites
synp01120  Microbial metabolism in diverse environments
synp01230  Biosynthesis of amino acids
Module
synp_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:synp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Syn7502_03422
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Syn7502_03422
Enzymes [BR:synp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Syn7502_03422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Peripla_BP_6 PrpR_N TPP_enzyme_N DrsE
Motif
Other DBs
NCBI-ProteinID: AFY75272
UniProt: K9SXC4
Position
complement(3353961..3355064)
Genome map
AA seq 367 aa AA seqDB search
MPSHISCPNTSCTVVRPSCGLICRYADLLPVSDRTPIVTLNEGNTPLIPALAVSKLIGRG
IKVLVKYEGLNPTGSFKDRGMTMAISKAKEQGAEVVVCASTGNTSAAAAAYAKRAGMKAF
VLIPDGKIAMGKLAQALIYGAEVIAIQGNFDRALELVRELGDKYPVTLVNSINPFRLQGQ
KTAAFEVVETLGDAPDWLCIPVGNAGNISAYWMGFKEYKNLGKCQKLPKMMGFQAAGAAP
LVTGKIFENPETIASAIRIGNPANWQSAIAVQNESNGEFNSVTDDEILAAYKLLAGEEGV
FCEPASAASVAGLLKFKDRVPDHATVVCVLTGNGLKDPNTAIAQSPAQHFHQEVIAELGT
IAKIMGF
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
gtgccttctcatatctcctgccctaatacttcttgtaccgtagttcgtccttcctgtggt
ctcatctgtcgttatgctgatttgttacctgttagcgatcgcacacccatagttacactc
aacgaaggtaataccccattaattccagctttagcagtatcaaagctaatcggtagaggg
atcaaggtattagttaagtatgaaggcttaaaccccacaggtagctttaaggatcggggg
atgacgatggcgatctccaaagcaaaggaacagggagcagaagttgtagtctgtgccagt
acgggaaatacctctgctgctgcggctgcctatgctaaacgggcgggaatgaaagctttt
gtcctaattccagatggtaaaattgccatgggtaaattggctcaggctttaatctatggt
gccgaggtcatagccatacagggtaactttgatcgggcattagagttagtgcgggaactt
ggtgataaatatcctgtaactttagttaattccattaatccgttccgtttacagggacaa
aaaaccgccgcctttgaagtggtagagaccttgggtgatgctcccgattggctttgtatt
cctgtgggcaatgcgggcaatatcagtgcctattggatgggatttaaggaatataaaaat
ttaggcaagtgtcagaaactaccgaaaatgatggggtttcaagctgcaggtgcagcaccg
ttggtaacgggtaaaatttttgagaatcctgaaactattgctagtgctattcgcattggt
aatcccgctaattggcagtcagcgatcgccgtgcagaatgaaagtaatggtgagtttaat
agtgtcacagatgatgaaattctggcagcctataaacttttagcaggggaagagggagtt
ttctgtgagccagccagtgcagcatcggttgctggtttattaaaattcaaagatcgagtt
cccgaccacgccacagtggtatgtgtattaactggaaatggcttaaaagaccccaatacg
gcgatcgcccaatctcccgcacaacattttcaccaagaagttattgctgaattaggaact
attgccaaaattatgggattttag

DBGET integrated database retrieval system