KEGG   Synechococcus sp. PCC 7502: Syn7502_03424Help
Entry
Syn7502_03424     CDS       T02371                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
synp  Synechococcus sp. PCC 7502
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:synp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Syn7502_03424
DNA repair and recombination proteins [BR:synp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Syn7502_03424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3355944..3356537)
Genome map
AA seq 197 aa AA seqDB search
MYTRPLANLIEQFQRLPGVGAKTAQRLALFILKRPTTEVEALANALLAAKEQVGCCSICG
HLSAEPICEICSNPNRDQSMICVVIDSRDLIALEKTREYRGKYHVLGGLISPMDGISPDQ
LNIQSLVRRVSQGGIHEVIMAISPTVEGETTTLYVGGLIKPFTRVTRIAFGIPMGGDLEY
ADEVTLAKALEGRRDLG
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
ttgtacactcgcccccttgccaacctgatcgaacagtttcaacgcttacctggagttgga
gccaaaactgcccagagactagcattatttatccttaaacgccctaccaccgaagtcgag
gctttagcaaatgctctactggctgctaaggaacaggtgggttgttgttcaatttgtggg
catctatcggcggaaccaatctgtgaaatttgtagtaatcccaatcgagatcaatccatg
atttgcgtagtcattgactctagggatttaatcgccttagaaaaaacccgtgaataccga
ggtaagtatcatgtgctaggtgggctaatttcgccaatggatgggatttctcctgatcaa
ttaaatattcagtcactggtacgcagagttagtcaaggtggaattcatgaagtaattatg
gcaatcagtcccacggttgaaggtgaaactactacgctctatgtaggtggcttaatcaaa
ccctttaccagagttacacgcattgctttcggaatacctatgggtggagatttagagtat
gccgatgaagtaaccttagcaaaagcactagaaggtcggcgggacttaggataa

DBGET integrated database retrieval system