KEGG   Synechococcus sp. PCC 7502: Syn7502_03594Help
Entry
Syn7502_03594     CDS       T02371                                 

Definition
ATP-dependent exoDNAse
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
synp  Synechococcus sp. PCC 7502
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:synp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Syn7502_03594
Enzymes [BR:synp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Syn7502_03594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSYN7502.01:complement(8201..10405)
Genome map
AA seq 734 aa AA seqDB search
MPDKTDYLQGVIERLTFHSEETGYAIARLKTPKSPDLITIVGNFANIQAGQTLALEGIWR
SHPKYGDQFQVSQYQETKPATLTGIEKYLGSGLIKGVGPVTAKRIVAHFGLDTLDIIENQ
IDRLIEVPGIAKKRVKMIQTAWSTQKSIKEVMVFLQGHSVSTTYAVKIYKTYGNDSISTV
TENPYKLATDIYGIGFFTADAIARNIGIEISSEFRSIAGIFHSLGEAGEEGHCYLPQSEL
IERTVKLLTLEEYQPDPNSIEALTHKLAINDQLIMQGDYQGQFICYKPSIYHTEKGLAER
IYQLLQHKITVDMDRVNNWIDRYTAHQSITLSAQQRQAVEMAATSSILILTGGPGTGKTT
TTRTIVALWKAMGKEIALASPTGRAAQRLQEVTGCEAKTLHRYLEFDPSSMGFKRNQDYP
LTAKAIAVDEASMLDIFLAFSLIKAIPIGTQLLLIGDTDQLPSVGAGNVLKDLIDSQHIP
VITLTEVFRQAQASQIIQNAHRINTGKYPQIEKATNQPQTDCLYLEMPTAEAGVQGICDL
ITHLIPNLGFNPQQDMQVLCPMTRGDVGTRNLNQVLQQLLNPPDHTKPEIKRGSTIFRLG
DRIMQQVNDYNREVFNGDIGTITGVDLEEQEITVIFGDRQVTYDSADLNEITLARATTIH
KAQGSEYPVVIIPMFMQHFLMLSRNLFYTGITRAKKLAIIVGESKAIGLAVKQVNDRNRY
TYLARRISKLANLE
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgccagacaaaaccgactatctccaaggtgtaattgaacgactaacctttcattccgaa
gagacagggtacgcgatcgcccgcctcaaaacacccaaatccccagacctaatcaccata
gtcggaaactttgccaacatccaagcaggacagaccctagcacttgaaggcatctggcgc
agccacccaaaatacggcgaccaattccaagttagccaataccaagaaactaaacccgcc
accctcacaggcattgagaaatatctaggtagtggtttaatcaaaggcgttggtccagtt
actgctaaacgcatcgtggcacactttggacttgataccctagacattattgaaaaccaa
attgatcgcctcattgaagttcctggtattgccaaaaagcgggtaaaaatgatccaaacc
gcatggtcaacccagaaatccatcaaagaggtcatggtattcctgcaaggacatagtgta
tccaccacctacgctgtcaaaatctacaagacctacggcaatgattcgatcagcaccgtt
actgaaaacccctataaacttgccaccgatatttatggcataggcttctttactgccgat
gcgatcgctcgaaatataggcattgaaatcagctcagaattccgctcaatagctgggata
ttccacagtttaggcgaagcaggagaagaaggacattgctacctaccgcaatctgaattg
atcgaacgcactgttaaattgctcaccctagaagagtatcaaccagaccccaacagcatc
gaagccctcacccacaaactggcaattaacgaccagctaattatgcaaggggactaccaa
gggcaattcatctgctacaaacccagcatctaccacaccgagaaaggattagcagagcgc
atctatcaactgctccaacacaaaatcacagtcgatatggatcgagtcaataactggatc
gatcgctataccgcccatcaaagcatcaccctctcggcacaacaacgccaagccgtagaa
atggcagcaacttcttcaatcctaattctcacaggtggacctggtacaggtaaaaccacc
accacccgcactatcgtcgccctctggaaagctatgggaaaagagatcgccctcgcgtca
cccacaggtagagccgcccaaaggttacaagaagtcacaggttgcgaagcaaagacctta
caccgttatctggaatttgaccctagttctatgggatttaaacgcaatcaagactatcct
cttactgccaaggcgatcgctgtggatgaagcttctatgttggacatattcttagcattc
tcattaatcaaagccattcccatcggtacacaactactcttaataggcgataccgatcaa
ctccccagtgtcggcgcaggaaatgtattaaaagatttaatcgattcccaacacatcccc
gtgatcactcttaccgaagtcttccgtcaggcacaggcaagccaaattattcaaaatgcc
caccgcatcaatacgggcaaatatccccagattgaaaaagccaccaatcaaccccaaacc
gattgtctctacttagaaatgccgacagcagaggcaggagtgcaaggcatttgcgaccta
atcacccatctcatacccaatctaggctttaatccccagcaggatatgcaggtactttgt
cccatgaccagaggcgatgtaggcactcgaaatctcaatcaagttctccaacaactgctc
aatccacctgaccataccaaacctgaaattaagcgaggtagtacgatcttccgtctgggc
gatcgcattatgcaacaggtaaacgactataaccgtgaagtatttaatggcgacatcggc
acaattacgggtgtagatttagaagagcaagaaattacagttatttttggcgatagacaa
gtcacctacgactccgcagacctcaatgaaatcaccctagctagagccactactattcat
aaagctcagggcagtgaatatcctgtggtgattattcccatgtttatgcaacactttctc
atgctctctcgcaatttgttctacacaggcattacccgtgccaaaaaactcgcaatcatc
gtgggagaatccaaagctataggattagcagttaagcaggtgaatgacagaaacagatat
acctaccttgctagaagaatctcaaaattagctaatcttgaataa

DBGET integrated database retrieval system