KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A0034Help
Entry
SYNPCC7002_A0034  CDS       T00664                                 

Definition
inositol monophosphatase family protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:syp00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
complement(30885..31730)
Genome map
AA seq 281 aa AA seqDB search
MDQQKLTEVLAIARQIGWGAGDVLQSYYKGDIKNISDKKDGPVTKADLAANHYILEAFQE
KLGTEDFAYLSEETYDGNKVEHPWVWIIDPLDGTRDFIDQTGEYAVHICLVHEGRPVIAV
VVVPEAEKLYFASKGNGTFVETRDGTVTPIKVSERNQPEDLYLVASRTHRDQRFQDLLDR
LPFKDRNYVGSVGCKIAHILEQKSDVYISLSGKSAAKDWDFAAPELILTEAGGKFSYFAG
NEVLYNQGDVVKWGGIMASNGPCHAELCQQAIAILAELDRT
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggatcagcaaaagttaacggaagttttggcgatcgcccgacaaatcggttggggtgca
ggggatgttctccaaagttattacaaaggagatattaaaaatatttctgataaaaaagat
ggccctgtcaccaaggcagatttagcagcaaatcactatattctggaagcgtttcaggaa
aagttaggcactgaagattttgcctatctcagcgaagaaacctacgacggcaataaagtt
gaacatccttgggtgtggattattgatcccctcgatggcacccgtgattttattgaccaa
acgggagaatatgccgttcacatttgccttgttcatgaaggtcgcccggtcattgcggta
gtggtcgtccccgaagcagaaaagctttatttcgcgtcgaaagggaatggcacttttgtg
gaaactcgtgatggcaccgtcaccccaattaaagtttctgagcgcaatcaaccagaagat
ttatatttagtcgccagccgtacccaccgggatcaacgcttccaggatttgttagatcgc
ctaccctttaaagatagaaattatgtggggagtgtcggctgtaaaattgcccatattctc
gaacaaaaatccgatgtttatatttctctatcggggaaatctgcagcaaaagattgggat
tttgcggccccggaactaatcctcacggaagcaggtggaaaatttagttattttgcaggc
aatgaagtgctctataaccaaggcgatgtggtgaagtggggcggcattatggcgtctaat
gggccgtgtcatgcagaactttgtcagcaggcgatcgccatccttgcagaactagatcgt
acatag

DBGET integrated database retrieval system