KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A0034Help
Entry
SYNPCC7002_A0034  CDS       T00664                                 

Definition
inositol monophosphatase family protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SYNPCC7002_A0034
Enzymes [BR:syp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     SYNPCC7002_A0034
Transfer RNA biogenesis [BR:syp03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    SYNPCC7002_A0034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
complement(30885..31730)
Genome map
AA seq 281 aa AA seqDB search
MDQQKLTEVLAIARQIGWGAGDVLQSYYKGDIKNISDKKDGPVTKADLAANHYILEAFQE
KLGTEDFAYLSEETYDGNKVEHPWVWIIDPLDGTRDFIDQTGEYAVHICLVHEGRPVIAV
VVVPEAEKLYFASKGNGTFVETRDGTVTPIKVSERNQPEDLYLVASRTHRDQRFQDLLDR
LPFKDRNYVGSVGCKIAHILEQKSDVYISLSGKSAAKDWDFAAPELILTEAGGKFSYFAG
NEVLYNQGDVVKWGGIMASNGPCHAELCQQAIAILAELDRT
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggatcagcaaaagttaacggaagttttggcgatcgcccgacaaatcggttggggtgca
ggggatgttctccaaagttattacaaaggagatattaaaaatatttctgataaaaaagat
ggccctgtcaccaaggcagatttagcagcaaatcactatattctggaagcgtttcaggaa
aagttaggcactgaagattttgcctatctcagcgaagaaacctacgacggcaataaagtt
gaacatccttgggtgtggattattgatcccctcgatggcacccgtgattttattgaccaa
acgggagaatatgccgttcacatttgccttgttcatgaaggtcgcccggtcattgcggta
gtggtcgtccccgaagcagaaaagctttatttcgcgtcgaaagggaatggcacttttgtg
gaaactcgtgatggcaccgtcaccccaattaaagtttctgagcgcaatcaaccagaagat
ttatatttagtcgccagccgtacccaccgggatcaacgcttccaggatttgttagatcgc
ctaccctttaaagatagaaattatgtggggagtgtcggctgtaaaattgcccatattctc
gaacaaaaatccgatgtttatatttctctatcggggaaatctgcagcaaaagattgggat
tttgcggccccggaactaatcctcacggaagcaggtggaaaatttagttattttgcaggc
aatgaagtgctctataaccaaggcgatgtggtgaagtggggcggcattatggcgtctaat
gggccgtgtcatgcagaactttgtcagcaggcgatcgccatccttgcagaactagatcgt
acatag

DBGET integrated database retrieval system