KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A0106Help
Entry
SYNPCC7002_A0106  CDS       T00664                                 

Gene name
gap
Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type I
  KO
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SYNPCC7002_A0106 (gap)
   01230 Biosynthesis of amino acids
    SYNPCC7002_A0106 (gap)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNPCC7002_A0106 (gap)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SYNPCC7002_A0106 (gap)
Enzymes [BR:syp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     SYNPCC7002_A0106 (gap)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
107108..108124
Genome map
AA seq 338 aa AA seqDB search
MIRVAINGFGRIGRNFLRCWAGRENSQLQVVGINATTDTKSNAHMLRYDTMLGKFDGEID
YDANSLTVNGNVIKCCSDRNPLNLPWKEWGVDLVIESTGVFNTEEGSSKHITAGAQKVLI
TAPGKGGHIGTYVVGVNADQYGHDKQNVISNASCTTNCLAPIVKVLNDRFGIVKGTMTTV
HSYTGDQRILDNSHRDLRRARAAAENIVPTSTGAAKAVALVIPEMKGKLNGIAMRVPTPN
VSVVDLVAQVAKPTIAEEVNQVLKEASETYMKGILAYTEEPLVSCDFRGTDVSSTIDGSL
TLAMDGDLIKVVAWYDNEWGYSQRVVDLAEIVAQNWQG
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgattagagtagcgattaatggatttggacgtattggacgcaacttcttgagatgttgg
gctggtcgcgaaaacagccaactccaagtcgttgggatcaatgcgaccaccgataccaaa
agtaatgcccacatgcttcgttatgacacgatgctgggtaaatttgatggcgaaatcgat
tatgacgccaactctctgactgtcaacggcaacgtaatcaaatgctgttccgacagaaac
cccctcaacctcccttggaaagagtggggcgtcgatttggtgatcgaatctaccggtgta
ttcaacaccgaagaaggatcttctaagcacattacagctggtgcacaaaaagtattgatc
acagcccctggtaaaggcggccatatcggcacctatgtagttggtgtaaacgccgatcag
tatggccacgacaaacaaaatgtcatcagtaatgccagctgtaccaccaactgcctcgcc
cccattgttaaagtactcaatgatcgttttgggatcgtcaaagggacgatgaccaccgtc
cacagttacactggcgaccaacgtatcctcgacaacagccaccgggatctccgtcgggcg
cgggcagccgcagaaaatattgtgccgacttctactggcgcagctaaagccgttgcctta
gttattcccgaaatgaagggtaagctcaacgggatcgccatgcgggtaccgactcccaac
gtctccgtagttgacctggttgcccaagtagcgaagcccaccattgctgaggaagttaac
caagttctgaaagaagcttctgaaacctacatgaaagggattttggcttacaccgaagaa
cccctcgtctcctgtgacttccggggaactgatgtctcttccaccattgacggtagcctc
accctcgccatggacggtgacctaattaaagttgtggcttggtacgacaacgagtggggt
tattctcaacgggttgttgacctcgcagaaatcgttgcccaaaattggcaagggtaa

DBGET integrated database retrieval system