KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A0110Help
Entry
SYNPCC7002_A0110  CDS       T00664                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SYNPCC7002_A0110
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNPCC7002_A0110
   00020 Citrate cycle (TCA cycle)
    SYNPCC7002_A0110
   00620 Pyruvate metabolism
    SYNPCC7002_A0110
Enzymes [BR:syp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SYNPCC7002_A0110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
110430..111740
Genome map
AA seq 436 aa AA seqDB search
MIHDIFMPALSSTMTEGKIVSWTKSPGDKVAKGETVVVVESDKADMDVESFNEGFLAAII
VDAGEEAPVGSAIALIAETEAEIPEAKQKAATLKGGSSAPAANPAPAPAPAAPSPEPAPV
VAAPAPTPAAPTPAPVVNDGRIIASPRAKKLAKEFGVDLKTVPGSGPHGRIVAEDVEKAA
GKAPTIAPAAVSTPAPTTSKPAAPAPAPVAVTPGEVVPLNTLQQAVVRNMNASLNVPTFH
VSYDITTDALDALYKQIKSKGVTMTGLLAKAVAVTLQKHPVVNASFGDNAIQYSSGINVA
VAVAMPDGGLITPVLQNADQMDIYSLSRKWKDLVDRARLKQLQPDEYSTGTFTLSNLGMF
GVSSFDAILPPGQGSILAIGGAQPKVVATPDGLFGVKKQMTVNITCDHRIIYGADAAAFL
KDLADLIENNTHSLTL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgattcacgatattttcatgcccgccctcagctctacgatgaccgaaggtaaaatcgtt
tcttggactaagtccccgggagataaagtcgctaaaggtgaaaccgttgtcgtggtggaa
tctgacaaagccgatatggacgttgagtcttttaacgaagggtttctcgcggcgattatc
gttgatgcaggggaagaggcaccagtgggttcggcgatcgccctcatcgctgaaaccgaa
gcagaaattccagaggccaaacaaaaagccgcgactctgaaagggggtagtagtgctcct
gctgctaatcctgcgcctgcacccgcccctgcggcacctagtccagaaccggctcccgtt
gtggcagccccggcgcctacacctgcggcaccgactcccgcaccagtggtcaacgatggc
agaattattgcttctccgagggcgaaaaaactcgccaaagaatttggtgttgatcttaaa
acagtgcctggttctggcccccacggtcgaattgtcgccgaagatgtcgaaaaagccgct
ggtaaagcacctactattgcccctgctgccgtatcaactccagcgccgacaaccagtaag
cctgccgccccagcgccagctcccgtcgctgtcactcctggtgaagttgtcccgctgaat
acgttgcaacaggcggttgtgcggaatatgaatgccagcctgaatgtacccaccttccat
gtgtcctatgacatcacgaccgatgccctagatgccctctacaagcaaattaagagtaag
ggcgtcaccatgacaggtctattggcgaaggccgtggctgtgaccctccagaaacatcca
gtagttaatgccagctttggggataatgcgatccaatacagcagtggtattaatgtggcg
gtggccgttgcgatgcccgacggcggcctgattacccctgtgctgcaaaatgccgatcaa
atggatatctattccctttcccgcaagtggaaagatttggtagaccgggcgcgcctcaag
caactgcagcccgatgagtacagcactggcacctttaccctctctaacctagggatgttt
ggggtcagcagttttgatgcgattttgccccctggtcaaggttctattttggcgattggg
ggtgctcaacctaaagtcgttgcgacgcccgacggtttatttggtgtgaaaaaacaaatg
accgtcaatatcacctgcgaccaccgcattatttatggtgccgatgcggcagcattcctt
aaggatttagctgacttgattgaaaataacacgcacagtctgaccctttag

DBGET integrated database retrieval system