KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A0110Help
Entry
SYNPCC7002_A0110  CDS       T00664                                 

Definition
(GenBank) dihydrolipoamide S-acetyltransferase; 2-oxo acid dehydrogenases acyltransferase (catalytic domain)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
syp  Synechococcus sp. PCC7002
Pathway
syp00010  Glycolysis / Gluconeogenesis
syp00020  Citrate cycle (TCA cycle)
syp00620  Pyruvate metabolism
syp01100  Metabolic pathways
syp01110  Biosynthesis of secondary metabolites
syp01120  Microbial metabolism in diverse environments
syp01130  Biosynthesis of antibiotics
syp01200  Carbon metabolism
Module
syp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNPCC7002_A0110
   00020 Citrate cycle (TCA cycle)
    SYNPCC7002_A0110
   00620 Pyruvate metabolism
    SYNPCC7002_A0110
Enzymes [BR:syp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SYNPCC7002_A0110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase PASTA
Motif
Other DBs
NCBI-ProteinID: ACA98125
CyanoBase: SYNPCC7002_A0110
CYORF: SYNPCC7002_A0110
UniProt: B1XLG5
Position
110430..111740
Genome map
AA seq 436 aa AA seqDB search
MIHDIFMPALSSTMTEGKIVSWTKSPGDKVAKGETVVVVESDKADMDVESFNEGFLAAII
VDAGEEAPVGSAIALIAETEAEIPEAKQKAATLKGGSSAPAANPAPAPAPAAPSPEPAPV
VAAPAPTPAAPTPAPVVNDGRIIASPRAKKLAKEFGVDLKTVPGSGPHGRIVAEDVEKAA
GKAPTIAPAAVSTPAPTTSKPAAPAPAPVAVTPGEVVPLNTLQQAVVRNMNASLNVPTFH
VSYDITTDALDALYKQIKSKGVTMTGLLAKAVAVTLQKHPVVNASFGDNAIQYSSGINVA
VAVAMPDGGLITPVLQNADQMDIYSLSRKWKDLVDRARLKQLQPDEYSTGTFTLSNLGMF
GVSSFDAILPPGQGSILAIGGAQPKVVATPDGLFGVKKQMTVNITCDHRIIYGADAAAFL
KDLADLIENNTHSLTL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgattcacgatattttcatgcccgccctcagctctacgatgaccgaaggtaaaatcgtt
tcttggactaagtccccgggagataaagtcgctaaaggtgaaaccgttgtcgtggtggaa
tctgacaaagccgatatggacgttgagtcttttaacgaagggtttctcgcggcgattatc
gttgatgcaggggaagaggcaccagtgggttcggcgatcgccctcatcgctgaaaccgaa
gcagaaattccagaggccaaacaaaaagccgcgactctgaaagggggtagtagtgctcct
gctgctaatcctgcgcctgcacccgcccctgcggcacctagtccagaaccggctcccgtt
gtggcagccccggcgcctacacctgcggcaccgactcccgcaccagtggtcaacgatggc
agaattattgcttctccgagggcgaaaaaactcgccaaagaatttggtgttgatcttaaa
acagtgcctggttctggcccccacggtcgaattgtcgccgaagatgtcgaaaaagccgct
ggtaaagcacctactattgcccctgctgccgtatcaactccagcgccgacaaccagtaag
cctgccgccccagcgccagctcccgtcgctgtcactcctggtgaagttgtcccgctgaat
acgttgcaacaggcggttgtgcggaatatgaatgccagcctgaatgtacccaccttccat
gtgtcctatgacatcacgaccgatgccctagatgccctctacaagcaaattaagagtaag
ggcgtcaccatgacaggtctattggcgaaggccgtggctgtgaccctccagaaacatcca
gtagttaatgccagctttggggataatgcgatccaatacagcagtggtattaatgtggcg
gtggccgttgcgatgcccgacggcggcctgattacccctgtgctgcaaaatgccgatcaa
atggatatctattccctttcccgcaagtggaaagatttggtagaccgggcgcgcctcaag
caactgcagcccgatgagtacagcactggcacctttaccctctctaacctagggatgttt
ggggtcagcagttttgatgcgattttgccccctggtcaaggttctattttggcgattggg
ggtgctcaacctaaagtcgttgcgacgcccgacggtttatttggtgtgaaaaaacaaatg
accgtcaatatcacctgcgaccaccgcattatttatggtgccgatgcggcagcattcctt
aaggatttagctgacttgattgaaaataacacgcacagtctgaccctttag

DBGET integrated database retrieval system