KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A0286Help
Entry
SYNPCC7002_A0286  CDS       T00664                                 

Gene name
thrC-II
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SYNPCC7002_A0286 (thrC-II)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SYNPCC7002_A0286 (thrC-II)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SYNPCC7002_A0286 (thrC-II)
Enzymes [BR:syp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SYNPCC7002_A0286 (thrC-II)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
complement(300041..301348)
Genome map
AA seq 435 aa AA seqDB search
MTQATLDTAVASLDTANFTALACKECGAEYEPKALHVCEFCFGPLEVKYDYEKIASKVSR
ESIEAGPKSIWRYKEFLPVAGEPIDVGTGFTPLLKANRLARRLGIKELYIKNDAVNMPTL
SFKDRVVSVALTRARELGFSTVSCASTGNLANSTAAIAAHAGLDCCVFIPSDLEAGKVLG
TLIYNPILMAVHGNYDQVNRLCSEVANSHGWGFVNINLRPYYSEGSKTLGYEVIEQLGWE
LPDHVVAPLASGSLFTKIYKGFNEFVKVGLVEDKAVRFSGAQAEGCSPISQAYKEGRDFI
TPVKPNTIAKSIAIGNPADGVYAVEIANKTNGNIEDVTDAEIVDGIKLLAETEGIFTETA
GGTTIAVLKKLVEAGKINPDEKTVVYITGNGLKTQEAVQNAAGEPLTIEANLESFEQALD
RARTLERLEWQQTLV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaagcaacccttgataccgccgtcgcctccctcgacaccgccaacttcaccgcc
ctcgcctgtaaggaatgtggcgctgagtacgaacccaaagccctccacgtgtgtgagttt
tgctttggccccctcgaagtgaagtatgactacgagaaaatcgccagcaaagtgagccgt
gaaagcatcgaagctggccccaagtccatctggcgctacaaagaatttttgcccgttgcc
ggagaacccattgatgtgggcactggctttacgcccctcctcaaagcgaaccgtttggcc
cgtcgtctcggcatcaaggagctttacattaaaaatgacgcggtgaatatgcccaccttg
agtttcaaggatcgggtggtatccgttgccctgacccgcgcccgcgaattaggtttctcg
actgtttcctgtgccagcactggtaatttggcaaactccactgcggcgatcgccgcccat
gccggattagactgttgcgtctttatcccctccgatctcgaagctgggaaagtcctcggc
acgctgatctacaatcccattctgatggccgttcacggcaactatgaccaggtgaaccgc
ctctgttctgaagttgccaactcccacggctggggctttgtgaatatcaacctccgcccc
tactactccgaaggttctaagaccctcggctatgaagtcatcgaacaacttggctgggaa
ctccccgaccacgtggttgcgcccctggcttccggttccctcttcaccaagatctataaa
ggctttaatgaattcgtcaaagtcggtcttgttgaagataaagcggttcgtttcagcggt
gcccaagctgaaggttgctctcccatttctcaagcctacaaagaaggccgtgactttatt
actcctgtgaagcccaacacgatcgccaagtccattgcgattggcaaccctgctgatggt
gtctacgccgtagaaatcgccaacaagaccaacggcaacattgaagacgtcaccgatgct
gaaattgttgacggcatcaaactccttgctgaaaccgaaggcattttcaccgaaactgct
ggtggcaccaccattgccgttttgaaaaaactcgtagaagcaggcaagatcaaccccgac
gagaagacagtcgtctacatcactgggaacggcctcaagacccaagaagcagtacaaaat
gctgctggtgaacccctcaccatcgaagccaacctcgaaagtttcgagcaggctcttgat
cgtgcccgcaccctcgagcgtctagagtggcagcaaactttggtatag

DBGET integrated database retrieval system