KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A0296Help
Entry
SYNPCC7002_A0296  CDS       T00664                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SYNPCC7002_A0296 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SYNPCC7002_A0296 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SYNPCC7002_A0296 (trpB)
Enzymes [BR:syp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SYNPCC7002_A0296 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
313609..314862
Genome map
AA seq 417 aa AA seqDB search
MTISPISPQDTTFNPNQPDAFGRFGKYGGKYVPETLMPALAELEAAYAQYRNDPTFQAEL
AGLLKDYVGRPSPLYFAERLTARYARPDGSGPQIYLKREDLNHTGAHKINNAIAQALLAK
RMGKKRIIAETGAGQHGVATATVCARFGLECIIYMGVQDMERQALNVFRMKLLGATVQPV
EAGTGTLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMMVRDFHAIIGAETRQQCAEK
WGGLPDILIACVGGGSNAMGLFHEFVKDSTVRLIGVEAEGSGITSGHHAATLTQGKPGVL
HGAMSYLLQDTEGQVVEAHSISAGLDYPGVGPEHSYLKDTCRAEYYSVTDQDAVAAFRRV
SELEGIIPALETSHAFAYLETLCPQLSGSPRIVINSSGRGDKDVQTVAKYLDRHGWD
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtgactatttctcccatttctccccaagacactacctttaaccccaatcaacccgatgcc
tttgggcgttttgggaaatatggtggtaaatatgtgcctgaaaccttgatgcccgctttg
gctgagttagaagcggcctatgcccagtatcgtaacgacccgacttttcaagcagaatta
gctgggctgctaaaagattatgttggtcgccccagtcccctttatttcgcggaacggctg
acggctcgctatgctcgccccgatggttctggcccgcaaatttacctgaaacgggaggat
ctcaaccacacgggtgcccacaaaatcaataatgcgatcgcccaggccctactcgccaaa
cgtatgggcaaaaaacgcatcatcgccgaaactggtgcgggtcaacatggcgttgccaca
gcgacggtctgtgcccggtttgggttggaatgcattatctatatgggggtgcaggacatg
gaacgccaagccctcaacgtcttccggatgaaattattaggggccaccgtccaacccgta
gaagcgggcactggaaccctcaaagatgccacctccgaggccattcgggactgggtaaca
aatgtagagacaacccactatatcctcggttccgtagctggcccccacccctacccgatg
atggtgcgagatttccacgcgatcattggtgccgaaactcgccaacaatgtgcagaaaag
tggggtggcctcccggatattctgattgcctgtgtggggggaggttccaatgccatgggg
cttttccacgaatttgttaaagattcgactgtgcgcttgattggcgttgaggccgaaggg
tctgggatcaccagtggtcaccacgcggctaccctcacccaagggaaaccaggggtccta
catggggccatgagctacctattgcaagacaccgaaggccaagttgtcgaggcccattcc
atcagtgcgggcttagattatcctggcgtcggcccggaacacagctacctcaaagatact
tgtcgggctgaatattacagtgtcaccgaccaggatgcagtggctgccttccgacgggtg
tccgagttagaaggaattattcccgccctggaaacctcccatgcctttgcttatttagaa
accctttgtccccagttgtcgggcagtccgcgcattgtgatcaacagttctggtcggggt
gataaggatgtacaaacggtggcaaagtatctcgatcgccatggttgggactaa

DBGET integrated database retrieval system