KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A0330Help
Entry
SYNPCC7002_A0330  CDS       T00664                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SYNPCC7002_A0330 (malQ)
Enzymes [BR:syp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SYNPCC7002_A0330 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
344426..345799
Genome map
AA seq 457 aa AA seqDB search
MGPTGFGNSPYLCYSAFAGNPMLLNLEWLASEDLLEEADLAACPSCPRDRVDYDQAIAFK
MPLLRKACKRFQAVATPERKQEFQTFCEEQAYWLNDYALFMALKEAHDGKSWYDWDAALA
WRDPKAIAQQTEILADQVFFHKYAQSEFFRQWSTLKSYANEKGIQIFGDLPIYVAHDSAD
VWGHPKIFRLDYETGAAKWMAGVPPDYFSETGQLWGNPVYNWRNLSRRHYSWWIERIKTM
LEYVDIVRIDHFRGFEAFWAVPQGEKTAMNGRWIKAKGDEFFALLKDKLGELPIVAEDLG
VITPDVEALRDKYRLPGMKILHFAFDSDRANPFLPFNYTNRNCIVYTGTHDNDTTVGWFD
KRSDEEKARVTDYLGCLCDEGIHWGLIRLALGSVANLAVFPLQDLLGLGSEAKMNTPGVA
AGNWTWRYQPEMLSDDLIGKLRYLVYLYGREPEYRGE
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
ctggggccaacggggtttgggaattctccttatctgtgttattcggcctttgcgggcaat
ccgatgctgttaaatttggagtggcttgcttcagaagatttattagaagaagctgatttg
gcggcctgtccgagttgtcctagagatcgagtggactatgatcaggcgatcgcctttaag
atgcccctcctgagaaaagcctgtaaacgcttccaggcggtggcgaccccagagagaaaa
caagaatttcaaaccttttgcgaagagcaggcctattggctcaatgattatgcactcttt
atggccctcaaggaagcccacgacggcaaaagctggtatgactgggatgctgcccttgct
tggcgtgacccaaaggcgatcgcccagcagacagagatcctcgccgatcaagtctttttc
cacaaatacgcccaatcagaatttttccgccagtggtcaaccctaaaaagctatgccaat
gaaaagggcatccaaatctttggggatttgccgatctatgtggcccacgacagtgccgat
gtgtggggccatccgaaaattttccgtctcgattatgaaaccggagctgccaagtggatg
gcgggagtcccaccggattatttcagcgaaacgggccaactctggggcaacccggtttac
aactggcgtaacctttcgcgccgtcactattcctggtggatcgagcgcattaaaaccatg
ctggagtatgtcgatattgttcgtatcgatcacttccggggttttgaagcgttttgggcg
gtgccccaaggggaaaaaacggcgatgaatggccgctggatcaaggctaagggtgacgaa
ttttttgcgttactcaaagataaactcggtgaattgcccatcgtcgctgaggatctgggg
gtaatcacgccggacgtggaggctctacgagataaatatcgcttgccaggtatgaagatt
ctgcactttgccttcgatagcgatcgcgccaatccgtttctaccgttcaactacaccaat
cgcaattgcattgtctacacaggcacccacgacaatgacaccacggtgggctggtttgac
aagcgcagtgacgaagaaaaggcgcgggtcacggattacctcggttgcctctgcgatgag
ggaattcattggggtctgatccgtctggcgttgggttccgtggcaaatctggcagttttc
cccctccaagatctacttggtttggggtctgaggcaaaaatgaatacccctggggtggcc
gccgggaactggacttggcgctaccagccggaaatgctgagtgatgacctcattggcaaa
ttacgctacctcgtctatctttacgggcgtgaaccggagtatcgaggcgaataa

DBGET integrated database retrieval system