KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A0452Help
Entry
SYNPCC7002_A0452  CDS       T00664                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:syp00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
482024..482920
Genome map
AA seq 298 aa AA seqDB search
MHLDQLNQQYGLPELSFGDRQPGFPVIKIKNRFATAEISLYGGQVLSFQPSNAQADLLFL
SDRSHYQPGKAIRGGIPICWPWFGADPDGLGRANHGFARDRLWTVRHTETLANGATRVIL
SLQDDEETRKIWDYAFELAIAVTVSESLDLELTSHNRDQRPMTITQALHTYFTIGDIQRV
KVLGLAGLDYIDKVDSTQQKSQIGEVTIQGELDRIYQHTPAHLTIEDSSLGRQIEIHSHH
SQTTIVWNPGATKTATMSDLPDAAYQKFLCVETANAAAETITLAPGERYTLGVTYRLL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgcatcttgaccaactcaatcaacaatacggcctgcctgaactttcctttggcgatcgc
caaccgggttttccggtgatcaaaatcaagaatcggtttgccacggcagaaatctctctc
tatggcggacaggtgctctctttccaaccaagcaacgcccaggccgatcttttatttttg
agcgatcgcagtcactaccaaccaggaaaagcgatccggggtgggattcccatctgttgg
ccctggtttggggcagacccggacggattagggcgagcaaaccatggttttgcccgcgat
cgcctctggactgtccggcataccgaaaccctcgccaatggcgcaacccgcgttatttta
agcttgcaagatgacgaagagacccgcaaaatttgggattatgcttttgaactggcgatc
gccgtcaccgtaagcgaaagcttagatctcgaactcacgagtcataaccgcgatcaaagg
ccgatgaccattacccaagctctccacacctacttcaccatcggcgacattcagcgggtg
aaagtgctgggtcttgcgggccttgattacatcgataaggtagacagcacacagcaaaaa
tcacaaattggcgaagtcacgatccagggggaactagaccgcatttatcaacatactcct
gctcacctcaccattgaggattctagcctggggcgacagatcgaaatccacagtcaccac
agccaaaccaccattgtctggaaccctggggccaccaaaactgcgacgatgagcgatctt
cccgatgctgcttatcaaaaatttctctgcgtcgaaacggccaatgctgccgccgagact
atcaccctcgctcccggcgaacgctataccctcggtgttacttaccgattgttgtga

DBGET integrated database retrieval system