KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A0562Help
Entry
SYNPCC7002_A0562  CDS       T00664                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SYNPCC7002_A0562 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SYNPCC7002_A0562 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SYNPCC7002_A0562 (trpA)
Enzymes [BR:syp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SYNPCC7002_A0562 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
588795..589589
Genome map
AA seq 264 aa AA seqDB search
MTSVSERFRSLKQAGQCALIPFITAGDPDLETTEQALKILDAAGADFIELGVPYSDPLAD
GPTIQAAATRALSRGVTLEQVLAIVQRVHGQLTAPIILFTYYNPIFYRGIDAFMAQVAAA
GVKGLVIPDLPLEESQMVLDAATSHGLDLILLVAPTSPTERIEAIAKASQGFIYLVSVTG
VTGARTSVASRVGELLPKLRQVTDKPIGVGFGVSDPAQARQLKEWGADGVIVGSAVVKRL
ATGTPAEGLAAVKEFCESLKEAIA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgacctctgtttctgaacgtttccgatccctcaagcaggcgggccaatgtgcgctgatt
cccttcattacagcgggtgatccagatttagaaacgacagaacaggccctcaaaatttta
gacgcagccggggctgattttattgaactcggcgtcccctattctgatcccctcgccgat
gggccgacaatccaagcggcggcaaccagggccttgagccggggcgtcacccttgagcaa
gttttagcgatcgtgcaacgagtccatgggcaattaacagcaccgattattttattcacc
tattacaatccgattttttatcggggcattgatgcttttatggcccaagtggcagcggcg
ggagtcaaaggtttggtgatcccggatctgcccctagaggaatcccagatggtgctggat
gcagcaacaagtcatggtcttgatttgattttattggtggctcccaccagtcccacggaa
cggatcgaggcgatcgccaaagcatcccaaggtttcatttacctcgtgagtgtgacgggg
gtcacgggggcgagaacctctgtggccagccgtgtcggggaactgttgccgaagttacgt
caagtgaccgataagcccatcggggttggtttcggggtttcggatccagcccaggcaaga
cagctaaaagaatggggcgcggatggcgtgatcgtcggcagtgcggtagtcaaacgcctc
gccactggaacgcccgccgaaggtttagcggcagtcaaagaattttgtgagtccctcaag
gaagcgatcgcctaa

DBGET integrated database retrieval system