KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A0595Help
Entry
SYNPCC7002_A0595  CDS       T00664                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:syp01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:syp01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:syp00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:syp00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:syp00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:syp00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
624033..624758
Genome map
AA seq 241 aa AA seqDB search
MRKIIIAGNWKMYKTQAESLDFLKALLPKIADDHEEREVVLCTPFTDLGLMSKSLHGTRV
RLGAQNIHWADEGAFTGEISGSMLTEMGVRYVIVGHSERRQYFGETDETVNQRLKAAQRH
GLTPILCVGESKAQRDAGETEAVIFAQLEQDLVDIDQNNLVVAYEPIWAIGTGDTCDATE
ANRVIGLIREKLTNKNVTIQYGGSVKPNNVDEIMAQPEIDGALVGGASLEAESFARLVNY
V
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaaagatcattattgcgggtaattggaaaatgtataagactcaagccgagtcttta
gactttctcaaagcattactgcccaaaatcgccgatgaccatgaagaacgagaagtggta
ctctgtacgccctttaccgatttaggcttaatgtccaagagtctccacggaacgcgggta
cgtctaggagcacaaaatatccactgggctgacgaaggtgcctttactggggaaatctcc
gggtcaatgctgacggaaatgggcgtccgttatgtcattgtgggccatagcgaaagacgg
caatattttggtgaaaccgatgaaaccgtaaatcaacgccttaaagcggcccaacgccac
ggtctaacgccgattctctgtgttggtgaaagcaaagcccaacgggatgctggcgaaacg
gaagcggtgatttttgcccagttagagcaagatttagtcgatattgatcaaaataacttg
gttgttgcctacgaacccatttgggccattggcacaggtgacacttgtgatgccaccgaa
gcaaaccgagtcattggtctgatccgcgaaaaactcaccaataaaaatgtcaccattcaa
tatggtggttccgtcaagccgaataacgttgatgagattatggcccagcccgaaattgat
ggagccttggtaggtggtgcgagcctagaggcagagagttttgcccgcttggtgaactat
gtgtaa

DBGET integrated database retrieval system