KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A0595Help
Entry
SYNPCC7002_A0595  CDS       T00664                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
syp  Synechococcus sp. PCC7002
Pathway
syp00010  Glycolysis / Gluconeogenesis
syp00051  Fructose and mannose metabolism
syp00562  Inositol phosphate metabolism
syp00710  Carbon fixation in photosynthetic organisms
syp01100  Metabolic pathways
syp01110  Biosynthesis of secondary metabolites
syp01120  Microbial metabolism in diverse environments
syp01130  Biosynthesis of antibiotics
syp01200  Carbon metabolism
syp01230  Biosynthesis of amino acids
Module
syp_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNPCC7002_A0595 (tpiA)
   00051 Fructose and mannose metabolism
    SYNPCC7002_A0595 (tpiA)
   00562 Inositol phosphate metabolism
    SYNPCC7002_A0595 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    SYNPCC7002_A0595 (tpiA)
Enzymes [BR:syp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SYNPCC7002_A0595 (tpiA)
Exosome [BR:syp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SYNPCC7002_A0595 (tpiA)
  Exosomal proteins of bladder cancer cells
   SYNPCC7002_A0595 (tpiA)
  Exosomal proteins of melanoma cells
   SYNPCC7002_A0595 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACA98602
CyanoBase: SYNPCC7002_A0595
CYORF: SYNPCC7002_A0595
UniProt: B1XPX4
Position
624033..624758
Genome map
AA seq 241 aa AA seqDB search
MRKIIIAGNWKMYKTQAESLDFLKALLPKIADDHEEREVVLCTPFTDLGLMSKSLHGTRV
RLGAQNIHWADEGAFTGEISGSMLTEMGVRYVIVGHSERRQYFGETDETVNQRLKAAQRH
GLTPILCVGESKAQRDAGETEAVIFAQLEQDLVDIDQNNLVVAYEPIWAIGTGDTCDATE
ANRVIGLIREKLTNKNVTIQYGGSVKPNNVDEIMAQPEIDGALVGGASLEAESFARLVNY
V
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaaagatcattattgcgggtaattggaaaatgtataagactcaagccgagtcttta
gactttctcaaagcattactgcccaaaatcgccgatgaccatgaagaacgagaagtggta
ctctgtacgccctttaccgatttaggcttaatgtccaagagtctccacggaacgcgggta
cgtctaggagcacaaaatatccactgggctgacgaaggtgcctttactggggaaatctcc
gggtcaatgctgacggaaatgggcgtccgttatgtcattgtgggccatagcgaaagacgg
caatattttggtgaaaccgatgaaaccgtaaatcaacgccttaaagcggcccaacgccac
ggtctaacgccgattctctgtgttggtgaaagcaaagcccaacgggatgctggcgaaacg
gaagcggtgatttttgcccagttagagcaagatttagtcgatattgatcaaaataacttg
gttgttgcctacgaacccatttgggccattggcacaggtgacacttgtgatgccaccgaa
gcaaaccgagtcattggtctgatccgcgaaaaactcaccaataaaaatgtcaccattcaa
tatggtggttccgtcaagccgaataacgttgatgagattatggcccagcccgaaattgat
ggagccttggtaggtggtgcgagcctagaggcagagagttttgcccgcttggtgaactat
gtgtaa

DBGET integrated database retrieval system