KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A0596Help
Entry
SYNPCC7002_A0596  CDS       T00664                                 

Gene name
chlD
Definition
magnesium chelatase ATPase subunit D
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SYNPCC7002_A0596 (chlD)
Enzymes [BR:syp01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     SYNPCC7002_A0596 (chlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
624873..626921
Genome map
AA seq 682 aa AA seqDB search
MPTLTTSRTTFPLTAVVGQDVIKTALLLGAVDPALGGVAIAGKRGTAKSVMARGIHSLLP
PIEVIKDNPFNCDVQNRSDWDDLTAATYGETASENIPTEVIAAPFVQIPLGVTEDRLLGS
VDVEASVRQGEPVFQPGLLAQAHRGVLYIDEINLLDDQIANQLLTVLTEGRNQIEREGIS
FSHPCRPLLIATYNPEEGNLREHLRDRIAITLSADRPLSLEERVAAVDQVVQYATAPKDF
LQSYEEDLDALRTQIILAREWLKEVKISKDQVAYLVSEAVRGSVEGHRAELFAVRVAMAA
AALDGRNVVIADDLRTAVELVILPRATTIPTPEDEDMQPPPPPPPPQSQDDQQDEEDQSQ
DEDQEDQDDDDQNEDQEEQPEQEPTIPEEFVFDPEGVVLDPGILAFAQMMQNKGNSGKRG
LIFSDDRGRYIKPMLPRGKVRRIAVDATLRAAAPYQKARRLRHPERKVIVEQSDLRSKRM
ARKAGALMIFLVDASGSMALNRMQAAKGAVMRLLTEAYENRDQIALIPFRGEMAEVLLPP
TRSITLARNRLETLPCGGGSPLSHGLTQAVHIGVNAQMSGDVGEVVIVAITDGRGNIPLS
RSLGEKPEEGEEKPDIKEELLDIAGKIRASGMKLLIIDTEKKFISSGFGKELAAKAGGKY
YRLPKATDQAIAAMAKGAMAEI
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgcctactctcacgacatcgcgcacgacctttcccctaacagcggtggttggtcaagat
gtaatcaaaactgctctcctgctgggggccgttgatcctgcccttggtggggtggcgatc
gccgggaaacggggcaccgcaaaatccgtgatggcccggggaatccattctcttttgccc
cccatcgaagttattaaggacaatccctttaactgtgatgtgcagaaccgcagtgattgg
gacgatctcaccgcagcgacctatggtgaaacggccagcgaaaacattcccacagaagtg
attgccgcgccttttgtgcaaattcccctgggcgttaccgaagatcgtctcttgggttct
gtggatgtcgaagcttccgtgcgccagggagaacctgttttccaacctggtctattggcc
caagcccatcggggtgtgttgtacatcgatgaaatcaacctccttgatgaccaaattgct
aaccaactcctgacggtcttaaccgaaggacgcaaccaaatcgaacgggaaggtattagt
ttttcgcacccctgtcggcccctcctcattgccacctataaccccgaagaaggaaatctg
cgggaacacctccgcgatcgcatcgccattaccctgtccgccgatcgccccctcagcctc
gaagaacgggtagcagcagtggatcaagtcgtgcaatatgccacggctcccaaggatttt
ctccaaagctatgaagaagaccttgatgccctccgcacccaaattatcctggcccgggaa
tggctcaaggaagtcaaaatcagcaaagaccaagtggcctacctcgtgagcgaagcagtg
cgtggtagtgtcgaaggtcaccgagccgaactgtttgccgtacgcgttgccatggctgct
gccgcccttgatggccgtaatgttgtgattgccgatgatctccgcacagcggtcgaactg
gtgattttgcccagggccacgacaatccccaccccagaagatgaggatatgcagccacct
ccaccgccgccaccccctcaatcccaagacgatcaacaggacgaggaggatcaatcccag
gacgaagatcaagaggatcaagacgacgacgatcaaaacgaagaccaagaggaacagccg
gaacaggagccgacgattcccgaggaatttgtatttgacccagagggggttgtgcttgac
ccagggattctcgcctttgcccagatgatgcaaaacaaaggtaactccgggaaacggggc
ttaattttctccgatgaccggggccgttacattaagccgatgttaccgcgggggaaagta
cggcgcattgcggtggatgcgaccctgcgggcggcggctccctaccaaaaggcgcgacga
ctgcggcaccctgagcgaaaagtgatcgtcgagcaaagtgatctgcgctctaaacggatg
gcccgtaaagcaggggctttgatgattttccttgttgatgcctctggatctatggctctg
aaccgaatgcaggcagcgaaaggggcggtgatgcgtctgctgacagaagcctatgaaaac
cgtgaccaaattgcgttgattccgttccggggcgaaatggcggaggtgcttttacctcct
acccgttcgattactttggcgcgcaatagattggaaacgttgccctgtggtggtggttca
ccgctgtcccatgggttaacccaagctgtgcatatcggtgtgaatgcgcaaatgtccggt
gatgtgggtgaagtagtaatcgtcgcgattactgatggtcggggcaatattcccctctct
cgttccctcggcgaaaaaccagaggaaggggaagaaaaacctgatattaaagaggaactt
ctggatattgccggtaaaatccgtgcttctgggatgaaactgctgattattgacacagag
aagaagtttatttcctctggcttcggtaaagagctagctgctaaagcggggggtaaatat
taccgtctgcccaaggccacagatcaggcgatcgccgccatggccaaaggagcaatggcc
gaaatttag

DBGET integrated database retrieval system