KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A0700Help
Entry
SYNPCC7002_A0700  CDS       T00664                                 

Definition
hypothetical protein
Organism
syp  Synechococcus sp. PCC7002
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
730750..731307
Genome map
AA seq 185 aa AA seqDB search
MTGQQSQYETLLAAYSDRQTAIALLKQHRPYLSLVPSVRRPEGSLIVMPLPVMRHLSRNE
QHSTPKTLILPCDLAILTCDPEWQIKLDAEIMVFIHRPGETFSELLLRWRHTQVYLDQDY
EWLMPESEAHMISNLPAQIHPLFVVFPTTPEHIIKGLTGAHLPFVLGESPFPEPESVPEV
FVTGN
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaccggacagcaaagtcagtatgaaacgcttttagcggcctacagtgatcgacaaacg
gcgatcgccttactgaagcaacatcgcccttacctttctttggtacccagtgtccggcgt
cctgaggggagtttaattgtgatgccgctgccggtgatgcgccacctcagcagaaatgaa
cagcattccactccaaaaaccttaattttgccctgtgatctggcgattttgacctgtgat
ccggagtggcaaattaagctagatgccgaaattatggtgtttatccatcggcctggggaa
actttttcagagctattgctgcgctggcgtcatacccaggtttaccttgatcaagattac
gagtggttaatgccagagtcggaggcccacatgatcagtaatcttccggcccaaattcac
cctttgtttgtggtgttcccgacaacccctgagcacattattaagggacttacgggggcg
catctcccctttgtcctgggggaatcaccgtttcctgaaccggagtctgtacctgaggtt
tttgttacgggaaattaa

DBGET integrated database retrieval system