KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A0809Help
Entry
SYNPCC7002_A0809  CDS       T00664                                 

Definition
(GenBank) Photosystem II reaction center N protein.-related protein
  KO
K02715  
PsbN protein
Organism
syp  Synechococcus sp. PCC7002
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
836362..836493
Genome map
AA seq 43 aa AA seqDB search
MDSATVLSIGIAVVVIAVTGFSIYTAFGPPSVELEDPFEDHED
NT seq 132 nt NT seq  +upstreamnt  +downstreamnt
atggattctgcaacagttcttagcatcggcattgcggtggttgtgatcgccgtaacaggg
ttttcgatttacacagccttcgggcctccttcggtagaacttgaggatccctttgaagat
catgaagattaa

DBGET integrated database retrieval system