KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A0818Help
Entry
SYNPCC7002_A0818  CDS       T00664                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:syp00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
844063..845241
Genome map
AA seq 392 aa AA seqDB search
MTNAKAISILGSTGSIGTQTLDIVRSHPDKFRVVGMAAGRNIQLLAEQVREFHPEIVATS
QESLLPELKSLLQDLEHQPQIIAGKAAIAEVARYGDAESVVTGIVGCAGLLPTIAAIEAG
KDIALANKETLIAGGPVVLPLIEKYGVKLLPADSEHSAIFQCLQGVPEGGLKRIILTASG
GAFRDLPVEKLATVTVKDALKHPNWSMGQKITIDSATLMNKGLEVIEAHYLFGKDYDDID
IVVHPQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSYPERIHTDWEQFDLVKAGDLTF
REPDHHKYPCMNLAYAAGRAGGSMPAVLNAANEQAVALFLEEKIEFLDIPRLIEKVCDRH
QNDNKTNPTLDDILQADQWARQAVLELQPQLA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgctaaagccatctctatccttggttccaccggatcaatcgggacgcaaacc
ctcgatattgtgcgatcgcaccccgataaattccgcgtggtggggatggccgctgggcgt
aacattcaactgctggccgaacaggtgcgggagttccacccagagattgttgccaccagc
caggaaagccttttacccgaactaaaatctctccttcaagatttagaacaccaaccccaa
atcatcgctggcaaagcggcgatcgccgaagtggcccgttatggtgatgccgaaagcgtg
gtaacggggattgtgggctgtgctggacttttaccgaccattgcggcgatcgaagccggc
aaagacattgctcttgctaacaaagaaaccctgatcgctggggggccagtggttttaccc
ttaatcgaaaaatatggcgtgaaactactgcccgctgactccgaacattccgcgatcttc
caatgtctccagggggtgcctgaaggaggtttaaagcggattattctcacggcctccggg
ggcgctttccgggatctgcctgtggaaaaattggccaccgtcactgtcaaagatgccctg
aaacatcccaactggtccatggggcaaaaaattaccatcgactccgctaccctgatgaac
aagggtctagaggtgatcgaagcccattatctctttggtaaagattacgacgacatcgac
attgtggtgcatccccagagcatcatccactccctaatcgagctgcaagatacctcggtt
ttagcccagttgggttggcctgatatgcgcttgcccctgctctatgccctctcctacccc
gaacgcattcacaccgattgggagcaatttgacctcgtgaaggccggcgatcttaccttc
cgggaaccggatcaccataaatatccctgcatgaatttggcctatgctgcgggacgggcc
gggggatcgatgccagcagttttaaatgcagcgaatgagcaagctgtggcccttttcctc
gaagaaaaaattgaattcctcgatatccctcgtctcatcgaaaaggtttgcgatcgccac
caaaacgacaacaagacaaacccgaccctagacgacattttgcaggcagatcaatgggcc
agacaagctgttcttgaattacagccacaattagcttaa

DBGET integrated database retrieval system