KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A0818Help
Entry
SYNPCC7002_A0818  CDS       T00664                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
syp  Synechococcus sp. PCC7002
Pathway
syp00900  Terpenoid backbone biosynthesis
syp01100  Metabolic pathways
syp01110  Biosynthesis of secondary metabolites
syp01130  Biosynthesis of antibiotics
Module
syp_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SYNPCC7002_A0818 (dxr)
Enzymes [BR:syp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     SYNPCC7002_A0818 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ACA98822
CyanoBase: SYNPCC7002_A0818
CYORF: SYNPCC7002_A0818
UniProt: B1XIF1
Position
844063..845241
Genome map
AA seq 392 aa AA seqDB search
MTNAKAISILGSTGSIGTQTLDIVRSHPDKFRVVGMAAGRNIQLLAEQVREFHPEIVATS
QESLLPELKSLLQDLEHQPQIIAGKAAIAEVARYGDAESVVTGIVGCAGLLPTIAAIEAG
KDIALANKETLIAGGPVVLPLIEKYGVKLLPADSEHSAIFQCLQGVPEGGLKRIILTASG
GAFRDLPVEKLATVTVKDALKHPNWSMGQKITIDSATLMNKGLEVIEAHYLFGKDYDDID
IVVHPQSIIHSLIELQDTSVLAQLGWPDMRLPLLYALSYPERIHTDWEQFDLVKAGDLTF
REPDHHKYPCMNLAYAAGRAGGSMPAVLNAANEQAVALFLEEKIEFLDIPRLIEKVCDRH
QNDNKTNPTLDDILQADQWARQAVLELQPQLA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgctaaagccatctctatccttggttccaccggatcaatcgggacgcaaacc
ctcgatattgtgcgatcgcaccccgataaattccgcgtggtggggatggccgctgggcgt
aacattcaactgctggccgaacaggtgcgggagttccacccagagattgttgccaccagc
caggaaagccttttacccgaactaaaatctctccttcaagatttagaacaccaaccccaa
atcatcgctggcaaagcggcgatcgccgaagtggcccgttatggtgatgccgaaagcgtg
gtaacggggattgtgggctgtgctggacttttaccgaccattgcggcgatcgaagccggc
aaagacattgctcttgctaacaaagaaaccctgatcgctggggggccagtggttttaccc
ttaatcgaaaaatatggcgtgaaactactgcccgctgactccgaacattccgcgatcttc
caatgtctccagggggtgcctgaaggaggtttaaagcggattattctcacggcctccggg
ggcgctttccgggatctgcctgtggaaaaattggccaccgtcactgtcaaagatgccctg
aaacatcccaactggtccatggggcaaaaaattaccatcgactccgctaccctgatgaac
aagggtctagaggtgatcgaagcccattatctctttggtaaagattacgacgacatcgac
attgtggtgcatccccagagcatcatccactccctaatcgagctgcaagatacctcggtt
ttagcccagttgggttggcctgatatgcgcttgcccctgctctatgccctctcctacccc
gaacgcattcacaccgattgggagcaatttgacctcgtgaaggccggcgatcttaccttc
cgggaaccggatcaccataaatatccctgcatgaatttggcctatgctgcgggacgggcc
gggggatcgatgccagcagttttaaatgcagcgaatgagcaagctgtggcccttttcctc
gaagaaaaaattgaattcctcgatatccctcgtctcatcgaaaaggtttgcgatcgccac
caaaacgacaacaagacaaacccgaccctagacgacattttgcaggcagatcaatgggcc
agacaagctgttcttgaattacagccacaattagcttaa

DBGET integrated database retrieval system