KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A0884Help
Entry
SYNPCC7002_A0884  CDS       T00664                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SYNPCC7002_A0884 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SYNPCC7002_A0884 (pyrB)
Enzymes [BR:syp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     SYNPCC7002_A0884 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
912665..913687
Genome map
AA seq 340 aa AA seqDB search
MGTVMTTATATWTRRHILSLMDFSVAELDAVLQTTTSLRDVLFRRMKKVPALQGQVVTNM
FFEPSTRTRSSFELAAKRLSADVMNFAPGSSSLSKGETILDTAKTYLAMGADIMVIRHQQ
SGVPQAIAAEMDRINSGVSILNAGDGLHAHPSQALLDLFTICRVLDPENPRCELLRGKKI
AIVGDIMHSRVARSNIWSLTTAGADVHLAAPPTLLPEGFREFATDAAGSLKLHWDIEPAL
KDADFVMTLRLQHERMTAHLLPSLREYHQRFGITGDRLKFCQPDVKVLHPGPVNRGVELA
SDVMDHPALSLVSEQVTNGVAVRMALLYLIGSSKANGSLN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgggaacagttatgacaacggcaacggccacctggacaaggcgacatattctgtcactg
atggatttttcggtggcggaactggatgcggtactgcagacgaccactagcttacgggat
gtcttatttcgtcgcatgaagaaggtgcccgcgctgcaagggcaggtggtcacaaatatg
ttttttgagccatcgacccgtacccggagtagttttgagttggcggcgaaacggctttcg
gcggatgtaatgaattttgcgccgggatcttcgtccctgagtaagggggaaacgattttg
gatacagcgaagacttatctggccatgggggcagacattatggtgattcgccaccagcaa
tcgggtgttccccaggcgatcgccgccgagatggatcggataaattcaggcgtcagtatt
ctcaatgcgggggatggcctccacgcccacccgtcccaagccctattggatctgtttacc
atttgccgggtactcgatcccgaaaatccccggtgtgaacttttgcggggcaaaaaaatt
gccattgtcggggatattatgcactctcgggtggcccgctcgaatatttggagtttgacc
accgctggggccgatgtccacttagccgcgccgcccactttgctcccagaaggatttcgg
gaatttgccacggacgccgcgggaagcctcaagctccactgggacattgaacctgctctc
aaagacgccgattttgtgatgaccctccgcctgcaacatgagcggatgaccgcccatctc
ctccccagtttgcgggaatatcatcaacggtttggcattacaggcgatcgccttaaattt
tgtcaaccagatgttaaagtgctccatccggggcctgtgaatcgtggcgtggaacttgcc
tccgatgtgatggatcatcccgccctcagtcttgtttctgagcaggtgaccaatggcgtc
gctgtacggatggcgttgctttatctcatcggtagcagtaaggccaatggttctctcaat
taa

DBGET integrated database retrieval system