KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A0884Help
Entry
SYNPCC7002_A0884  CDS       T00664                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:syp00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:syp00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
912665..913687
Genome map
AA seq 340 aa AA seqDB search
MGTVMTTATATWTRRHILSLMDFSVAELDAVLQTTTSLRDVLFRRMKKVPALQGQVVTNM
FFEPSTRTRSSFELAAKRLSADVMNFAPGSSSLSKGETILDTAKTYLAMGADIMVIRHQQ
SGVPQAIAAEMDRINSGVSILNAGDGLHAHPSQALLDLFTICRVLDPENPRCELLRGKKI
AIVGDIMHSRVARSNIWSLTTAGADVHLAAPPTLLPEGFREFATDAAGSLKLHWDIEPAL
KDADFVMTLRLQHERMTAHLLPSLREYHQRFGITGDRLKFCQPDVKVLHPGPVNRGVELA
SDVMDHPALSLVSEQVTNGVAVRMALLYLIGSSKANGSLN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgggaacagttatgacaacggcaacggccacctggacaaggcgacatattctgtcactg
atggatttttcggtggcggaactggatgcggtactgcagacgaccactagcttacgggat
gtcttatttcgtcgcatgaagaaggtgcccgcgctgcaagggcaggtggtcacaaatatg
ttttttgagccatcgacccgtacccggagtagttttgagttggcggcgaaacggctttcg
gcggatgtaatgaattttgcgccgggatcttcgtccctgagtaagggggaaacgattttg
gatacagcgaagacttatctggccatgggggcagacattatggtgattcgccaccagcaa
tcgggtgttccccaggcgatcgccgccgagatggatcggataaattcaggcgtcagtatt
ctcaatgcgggggatggcctccacgcccacccgtcccaagccctattggatctgtttacc
atttgccgggtactcgatcccgaaaatccccggtgtgaacttttgcggggcaaaaaaatt
gccattgtcggggatattatgcactctcgggtggcccgctcgaatatttggagtttgacc
accgctggggccgatgtccacttagccgcgccgcccactttgctcccagaaggatttcgg
gaatttgccacggacgccgcgggaagcctcaagctccactgggacattgaacctgctctc
aaagacgccgattttgtgatgaccctccgcctgcaacatgagcggatgaccgcccatctc
ctccccagtttgcgggaatatcatcaacggtttggcattacaggcgatcgccttaaattt
tgtcaaccagatgttaaagtgctccatccggggcctgtgaatcgtggcgtggaacttgcc
tccgatgtgatggatcatcccgccctcagtcttgtttctgagcaggtgaccaatggcgtc
gctgtacggatggcgttgctttatctcatcggtagcagtaaggccaatggttctctcaat
taa

DBGET integrated database retrieval system