KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A0970Help
Entry
SYNPCC7002_A0970  CDS       T00664                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SYNPCC7002_A0970
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SYNPCC7002_A0970
Enzymes [BR:syp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SYNPCC7002_A0970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
complement(998293..998757)
Genome map
AA seq 154 aa AA seqDB search
MALPTALKTLDGAPLSPETLENKVVLFVNVASKCGLTPQYSGLVALDQEYGDRGLVIVGV
PCNQFGAQEPGTPDEIKDFTKTKYDVDFTLLEKQDVNGANRSPLYQFLVGNGPDIAWNFG
KFLVGRDGEVIERFEPQTAPDDANLKAAIEKALG
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggctttacccacagcgttaaaaaccctagacggcgcgcccctcagcccggaaaccctc
gaaaataaagtcgttttattcgtgaatgtagcgagcaaatgcggcctgacgccccagtac
agtggcctggttgccctcgatcaagaatatggcgatcgcggtttggtgattgtcggcgtt
ccttgtaatcagttcggcgcccaggaacccggcacccctgacgaaatcaaagatttcacc
aagaccaaatatgacgtagattttacgctcctcgaaaaacaggatgtcaacggcgccaac
cgcagccctctgtaccagtttctcgtgggaaatggccccgacatcgcctggaacttcggc
aaattcctcgtcggccgtgacggtgaagtcatcgaacgctttgagccccagacggcccct
gatgacgcaaacctgaaagcggccattgaaaaagctttgggttaa

DBGET integrated database retrieval system