KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A0970Help
Entry
SYNPCC7002_A0970  CDS       T00664                                 

Definition
(GenBank) glutathione peroxidase
  KO
K20207  
hydroperoxy fatty acid reductase [EC:1.11.1.22]
Organism
syp  Synechococcus sp. PCC7002
Brite
Enzymes [BR:syp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.22  hydroperoxy fatty acid reductase
     SYNPCC7002_A0970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
Position
complement(998293..998757)
Genome map
AA seq 154 aa AA seqDB search
MALPTALKTLDGAPLSPETLENKVVLFVNVASKCGLTPQYSGLVALDQEYGDRGLVIVGV
PCNQFGAQEPGTPDEIKDFTKTKYDVDFTLLEKQDVNGANRSPLYQFLVGNGPDIAWNFG
KFLVGRDGEVIERFEPQTAPDDANLKAAIEKALG
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggctttacccacagcgttaaaaaccctagacggcgcgcccctcagcccggaaaccctc
gaaaataaagtcgttttattcgtgaatgtagcgagcaaatgcggcctgacgccccagtac
agtggcctggttgccctcgatcaagaatatggcgatcgcggtttggtgattgtcggcgtt
ccttgtaatcagttcggcgcccaggaacccggcacccctgacgaaatcaaagatttcacc
aagaccaaatatgacgtagattttacgctcctcgaaaaacaggatgtcaacggcgccaac
cgcagccctctgtaccagtttctcgtgggaaatggccccgacatcgcctggaacttcggc
aaattcctcgtcggccgtgacggtgaagtcatcgaacgctttgagccccagacggcccct
gatgacgcaaacctgaaagcggccattgaaaaagctttgggttaa

DBGET integrated database retrieval system