KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A1000Help
Entry
SYNPCC7002_A1000  CDS       T00664                                 

Gene name
chlH
Definition
magnesium-chelatase subunit H
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SYNPCC7002_A1000 (chlH)
Enzymes [BR:syp01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     SYNPCC7002_A1000 (chlH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
1029258..1032974
Genome map
AA seq 1238 aa AA seqDB search
MKRIVIITGFEAFNASLYRDAAQKAIARCPDLEVLTFNDRDLVSQPDAVVQALQGADVLF
ASLIFDYDQVIWLRERVENIPVRLVFESALELMALTRLGKFIIGEQPKGMPKPIKFILSK
FTNSKEEDKLAGYLSFLKTGPKLLKYIPAKKVQDLRNWLIIYGYWNAGGTDNVAAMCWAI
AANYLGLEIGELPAVVETPNLGLLHPDHDGYFLSPQAYLDWHHRIFPEQKLNPVVAVLLY
RKHVVTKQPYIPQLIRKFEADGLVPLPIFINGVEAHVIVRDWLTTDYEQHQRLHGQVAIK
SLKADAVRVEGIVSTIGFPLVGGPAGSMEAGRQVEVAKSILTAKNIPYLVAAPLLIQDLH
SWTRQGIGGLQSVVLYALPELDGAIDTIPLGGLVGEDIYLIPERIKRLTGRLKNWIRLKN
TAPGDRQLAILLYGFPPGYGATGTAALLNVPKSLVNLLKTLQAQGYDVGNFPEDGEEIIR
LVKAADEAYRLDPALAPQQTLENIDLKTMDRWLGYLLTQKIEKQWQSLTNTGLKTFGGKC
QVGGVQFGKVWIGVQPPLGISGDPMRLMFEKDLTPHPQYAAFYKWLQNEFRADALIHFGM
HGTVEWLPGSPLGNTSYSWSDILLGNLPNLYIYAANNPSESILAKRRGYGTLISHNVPPY
GRAGLYKELLVLRDLIGEYREDPEKNDALRPDIIQKIVDLGLPEDCPFTVGQEQGSEFTV
ENAPLFSKTALQNYFVHIYEYLQTLEQRLFSSGLHVLGEKPSPEIIQSYLAAYFGDRLPE
NVLTQVAQGEQEITCNQPELLAEAREIGDRLLQTDDEMTNLLKGLNGEYIPPAPGGDLLR
DGLGVLPTGRNIHALDPYRMPSPAAYARGREIGKKIIQQHLEETGNYPETVAVMLWGLDA
IKTKGESLGILLELVGAEPIKEGTGRIVRYELLPLAVVGHPRIDILANLSGIFRDSFVNI
IELLDDLFHRAATVDEDPAQNFIRKHSLELQAEGVENTTARLFSNPAGDFGSLVNDQIVE
GNWDNSDELAKTWEGRNQYSYGRNDKGQARPEVLKKLLQTGDRLVQEIDSVEYGLTDIQE
YYANTGGLKKAAENASGKTVTASFVESFSKDTTPRKLESVLRMEYRSKLLNPKWAEAMAD
QGSGGAYEISQRMTALIGWGGTVDFQDQWVYDQAAETYALDATMAQKLRDANPEAFRNIV
GRMLEAHGRGFWEASDEKLQKLSDLYDLTDDVLEGITT
NT seq 3717 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcattgtgatcatcaccgggtttgaagcgtttaatgccagcttgtatcgggat
gctgcccaaaaggcgatcgcccgctgtcccgacctggaggtgttgacctttaacgaccgg
gatttggtcagtcaaccggatgccgtggtccaagctttacagggggccgatgttcttttc
gcgagtctgatttttgactatgaccaggtgatttggctgcgggaacgggtcgaaaatatt
ccggtgcgtcttgtgtttgagtcggccctggagctgatggccctgactcggttgggtaag
ttcatcatcggggagcaacccaaggggatgccgaagccgattaaatttatcctgagcaaa
ttcaccaacagcaaagaagaggataagctcgctggctatctgagtttcctcaagactggg
ccgaagctgctgaaatatattcccgcgaaaaaagttcaagatctgcgcaattggctgatt
atctatggctattggaatgcgggcggaacggacaatgtggcggccatgtgttgggcgatc
gccgcaaattatttgggtttagaaatcggggaattgccggctgtggtagaaacgccgaac
ctgggtctgctccatcctgaccatgatggctattttctcagtccccaggcttacctcgat
tggcatcaccgaatctttccagagcaaaaattaaaccccgtcgttgccgtcctcctctac
cgcaaacacgttgtcaccaagcaaccttacattccccaactgattcgcaaatttgaagct
gatgggttggtgcccctgccgatttttatcaacggtgttgaagcccatgtaatcgtccgg
gattggctgaccaccgactatgaacagcatcaaaggctccatggccaggtggccattaaa
tctctcaaagccgatgcggttagggttgaaggcattgtttcaacgattgggtttcccctg
gtgggtggccctgccggttccatggaggcagggcggcaagtggaagtggcgaaaagtatc
ctcacagcgaaaaatattccctacctcgttgcggctcccttgttaatccaagacctccat
tcctggacgagacaagggattggcggcctccaaagtgtggtgctctatgccctgccagaa
ctggatggggcgattgatacgattcccctcggtggcctcgtcggggaagatatttacttg
atccccgaacggataaaacgactcacaggacggctaaaaaattggattcgtctgaaaaat
acggccccaggcgatcgccaactggccattttgctctatggctttccgccaggctacggg
gcgacgggcacagcggcattattaaacgtccccaaaagtttggtcaatcttctcaaaacg
ctccaggctcagggttacgacgtggggaattttccagaagatggggaggaaattattcgt
ttggtgaaagcggctgatgaagcctaccgccttgatcctgccttggcaccccagcagacc
ctggaaaatatcgatctcaaaaccatggatcgttggttgggttatcttctgacccagaaa
attgaaaaacaatggcaaagtttaacgaatacgggtctaaaaacctttggcggcaaatgt
caggtggggggcgtccagttcgggaaggtgtggatcggcgtgcagccgcccctgggtatc
tccggtgacccgatgcggttgatgttcgagaaagatctaacgccccatccccaatacgct
gctttttataagtggctccaaaatgaatttcgcgccgatgccctgattcactttgggatg
catgggacggtggaatggctgcccggttcgcccctaggaaataccagctattcttggtcg
gatattttgttgggaaatctgccaaatttatatatttatgcggcgaataatccttcagag
tcgattttggcgaagcggcgcggttacggcaccctgatttcccacaatgtgcccccctat
ggtcgggccggtttatacaaagaactgttggtgctgcgggatttgattggggaatatcgc
gaagatccagagaaaaatgacgctctccgcccggatattattcaaaaaattgttgatctg
ggcctgccggaagattgtccatttacagtaggccaggagcaggggagcgaatttacggtc
gaaaatgcccccttattcagcaaaaccgccctccaaaattatttcgtccacatttatgaa
tacctacaaaccctagagcaacgtctcttttcctctggtctccatgtcctgggggaaaaa
cccagccccgaaattatccaaagttacctcgcggcctattttggcgatcgcctgccagaa
aatgtcctcacccaggtcgcccagggagagcaggaaattacttgcaatcaaccggaactt
ttggcagaagcacgggaaattggcgatcgcctcttgcaaacggacgacgaaatgaccaat
ttgcttaagggtttgaacggcgaatatattcccccggcccctgggggcgatctgctgcgg
gatggtctgggcgttttacccaccggacgcaatatccatgccctcgatccctaccggatg
ccttctccggcggcctatgctcgcggtcgggaaattggcaaaaaaatcatccagcaacac
cttgaggaaacgggcaattatccagaaacggtggcggtgatgctctggggtttggatgct
attaaaacaaagggagaatccttggggattctgctggagttggtgggggcagaaccgatt
aaggaagggacggggcgcattgtccgctatgaattattgcccctggcagtcgtcggccac
cctcgcattgatattttggcgaatctgtcgggcattttccgggatagttttgtcaacatc
attgaactactcgatgatttgttccaccgggccgccaccgtagacgaagatcctgcccaa
aactttatccgcaaacacagtctcgaactccaggctgaaggagtcgaaaataccaccgcc
cgcttgttttccaatcctgccggggattttggctccctggtgaatgatcaaatcgtcgaa
ggcaactgggacaacagcgatgaactggcgaaaacctgggaaggccgcaatcaatacagc
tatggccgcaatgataagggtcaggcacgcccggaggtcttgaaaaaattactccaaaca
ggcgatcgccttgtgcaagaaattgactcggtagaatatggtctcacagatatccaggaa
tattacgccaataccgggggtctgaaaaaagcagcggaaaatgccagcggcaagacggtg
acagccagctttgtggaaagtttctcaaaagatacaacgcctcgcaaattagaatcagtc
ctgcgcatggagtaccgttcaaaactgctcaaccccaagtgggctgaggcgatggccgat
caggggtctgggggagcctatgaaatttcccagcgaatgacagctttaatcggttggggt
ggcacagtcgatttccaggatcaatgggtctatgaccaagccgcagagacctatgccctc
gatgcaacgatggcgcaaaaattgcgagatgcgaaccccgaagcttttcggaatattgtc
gggcggatgttggaagcccatgggcgcggtttctgggaagcttccgatgaaaaattgcaa
aaactaagtgatctttatgaccttacggacgatgttttagaaggaattacaacttaa

DBGET integrated database retrieval system