KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A1105Help
Entry
SYNPCC7002_A1105  CDS       T00664                                 

Gene name
murA
Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
syp  Synechococcus sp. PCC7002
Pathway
syp00520  Amino sugar and nucleotide sugar metabolism
syp00550  Peptidoglycan biosynthesis
syp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SYNPCC7002_A1105 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SYNPCC7002_A1105 (murA)
Enzymes [BR:syp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     SYNPCC7002_A1105 (murA)
Peptidoglycan biosynthesis and degradation proteins [BR:syp01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   SYNPCC7002_A1105 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase 7TM_GPCR_Srh
Motif
Other DBs
NCBI-ProteinID: ACA99106
CyanoBase: SYNPCC7002_A1105
CYORF: SYNPCC7002_A1105
UniProt: B1XJX8
Position
complement(1133517..1134848)
Genome map
AA seq 443 aa AA seqDB search
MEDRPIKTSAPLTPTRATAETILKIEGRHPLSGEVRISGAKNSALAIMAGTLLCSDQCRL
TNIPDLADIKRMAEVIAALGVQIVATPGNLDFDTRHLRTAEAPYELVSKLRASFFVIGPL
LARLGEAKVPMPGGCAIGARPVDLHVRGLQAMGAEVIIEHGVVQATVKGNRRRLQGAKIY
LDYPSVGATETLMMAATLAEGETIIENAAQEPEIVDLANFCRSMGAYISGDGSNKIVIQG
CDRLHATDYPIIPDRIEAGTFLVAGAITQSEFSVFPVVPDHLLPVIAKLEATGTKVIAEG
PNRLRIKPQGILRATDIETLPYPGFPTDMQAQFMALLTLCEGSSVVTETVFENRMHHVAE
FKRMGADVKVKGNNAIIKGVPFLSGAPVMATDLRASAALVLVGLAAEGTTIMREVHHMDR
GYDDLEGKFKALGARIERLTATL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
gtggaggatcgacccattaaaacttctgcccccctcacccccacccgtgcgaccgctgaa
accatccttaaaattgaagggcgacatcccctcagtggcgaggttaggatcagtggcgcg
aaaaattctgccctggccatcatggcgggaaccctactctgtagtgatcaatgtcgtctg
acaaatatccccgacttggcggatatcaaacggatggccgaagtgattgccgcccttggg
gttcaaatcgttgcgacccctggtaaccttgatttcgatacccgtcaccttaggacagca
gaagcgccctacgaattggtatccaagctgcgggcgagcttttttgttattggcccactc
ctggcccgccttggggaagctaaagtgccgatgccggggggctgtgccattggtgctagg
cccgtagatctccatgtgcgaggtctccaggcgatgggggccgaggtgattattgaacat
ggggttgtccaagcgacagtcaagggaaatcgacgacggctccagggggccaaaatctac
ttagattatccgagcgttggggcgaccgaaaccctgatgatggcggcaaccctcgctgaa
ggggaaacaatcattgaaaatgccgcccaggagccagagattgttgatctggcaaacttc
tgtcggtctatgggggcatacattagcggagatggcagcaacaaaattgtgattcaaggg
tgcgatcgcctccacgctaccgactacccgattattcccgaccgcattgaagccgggact
tttctcgtggccggggccattacccagtcagaatttagcgtctttcccgtcgtcccagac
catcttttaccggtgattgccaagctcgaagcaacggggacaaaggtgattgccgaaggg
ccgaaccgtctgcggatcaaaccccaagggattctccgggcgacggatatcgaaaccctg
ccctatcctggtttccccacggatatgcaagcccagttcatggcgttgctcaccctctgt
gaagggagcagtgtcgtcacggaaacggtttttgaaaaccggatgcaccacgtcgcagaa
tttaagcgcatgggggcggatgtcaaagtcaagggcaataacgccattattaaaggggta
ccttttttgtctggggctcccgtaatggcgaccgatctccgggcttcagcagccttggtt
ctggttggtttagcggctgagggcacaaccatcatgcgcgaggtacaccacatggatcgg
ggctatgatgaccttgaagggaagtttaaagctctaggggcaaggattgagcgtctgact
gcaaccctctaa

DBGET integrated database retrieval system