KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A1109Help
Entry
SYNPCC7002_A1109  CDS       T00664                                 

Gene name
speB
Definition
(RefSeq) agmatinase
  KO
K01480  
agmatinase [EC:3.5.3.11]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SYNPCC7002_A1109 (speB)
Enzymes [BR:syp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SYNPCC7002_A1109 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
complement(1136605..1137498)
Genome map
AA seq 297 aa AA seqDB search
MSQFVLQDFIGSEVERSYAESPVVILPIPYEATTTYRKGCEWGPDALLEASHQLECYDDE
LRRETCFDVGIFTHGAIADTRQNPGLSAEEMLAVTSETTQNLLQDGKFVIALGGEHAITT
GVVKGHLEFYQEPFTVVQIDAHADLRQSYEGSEHNHACIMRRVMDLGLPSLPVAIRSLCR
EEADLLAAKEIPVIWAWEMQNDPNWIETAIANIKTEKVFLTIDLDGIDPTLIAGVGTPEP
GGMDWYSTLRFLRRLFREKQVIGCDIMELAPLDDSVVSEYTAAKLVYKLIGYWYENR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaatttgtcttacaagatttcattggttctgaagtggaacggagctacgccgaa
tctccggtggtgattttgcccattccctacgaagcgacaaccacctatcgcaaagggtgt
gaatgggggccggatgcactgttagaagcgtcccatcagctggaatgttatgacgatgag
ttgcgccgggaaacttgttttgatgtggggatttttacccatggggcgatcgccgatacg
cgccagaatcctggactgtccgccgaggaaatgttagcggtcaccagcgaaaccacccaa
aatctcttgcaagatggcaaatttgtgattgccctggggggagaacacgccattactaca
ggggtcgtgaaaggtcatctggagttttaccaagaaccctttacggtggtacaaattgat
gcccatgcggatctgcgccagagctacgaaggttctgaacataaccatgcttgcattatg
cgacgggtaatggatttggggttgccgagtttgcctgtggcgatccggagcctctgtcga
gaagaagcggatttattggcggcgaaggaaattccggtgatttgggcatgggagatgcaa
aatgaccccaactggatcgaaacggcgatcgccaatattaaaacggaaaaagttttcctt
accattgacctcgacggcattgacccgaccctcatcgctggcgtcggcacccctgaaccc
ggtggcatggattggtacagcaccctgcgctttttgcgtcgcctgtttcgggaaaaacaa
gtgatcggctgcgacatcatggaactggcccccttagatgactctgtggtttctgagtac
accgccgccaagctggtgtataaactcattggctactggtacgaaaatcgctag

DBGET integrated database retrieval system