KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A1270Help
Entry
SYNPCC7002_A1270  CDS       T00664                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:syp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SYNPCC7002_A1270 (ruvA)
Enzymes [BR:syp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SYNPCC7002_A1270 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
complement(1315644..1316273)
Genome map
AA seq 209 aa AA seqDB search
MFSYLKGEAIAIHRNLQGRFFLILEVRDIGYEIQVPGRLAQELAAAIGQPQHIFVHSQQR
EDGTYLYGFASAAARDLFRQLISVSGIGAQGAIALLDTLTLPELVQAIVTADHRQLAKAP
GIGKKTAERLALELRSKLSQWRDQFSLPDTAAQPNAAVHEDLELTLLALGYQETEIRGAI
ATLSQDSILLQNDNADEWIRRAITLLSQT
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgtttagttatcttaagggagaggcgatcgccatccaccggaatttgcaggggcgtttt
tttctaattctcgaagtaagggacattggctacgagatccaagtgccaggacgcctcgcc
caggagttggcagccgcaatcggccaaccccaacacatttttgtccacagtcagcaacga
gaggacggcacctacctctacggctttgccagcgctgccgcccgggatttatttcggcag
ctgatcagtgtcagtggcattggtgcccagggggcgatcgccctacttgatactctaacc
ttgccggaattggtacaggccattgtcaccgccgatcatcgtcagctagccaaagcgccg
ggcattggcaaaaaaaccgccgaacggcttgccctcgaactgcgcagcaaactcagccaa
tggcgagatcaattttcgcttcccgacacagccgctcaacccaatgccgctgtccacgaa
gatttggaattaaccttgttggccttgggataccaagaaaccgaaatccgtggggcgatc
gccaccctcagtcaagactcgattctgttgcaaaatgacaatgccgacgaatggatccgg
cgggccatcactctcctaagccaaacataa

DBGET integrated database retrieval system