KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A1294Help
Entry
SYNPCC7002_A1294  CDS       T00664                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SYNPCC7002_A1294 (folP)
Enzymes [BR:syp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SYNPCC7002_A1294 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
1344848..1345705
Genome map
AA seq 285 aa AA seqDB search
MEPLTLRNQTFTWGDRTYVMGILNVTPDSFSDGGQFNSVAAALAQAEKMVAAGIDILDIG
GQSTRPGAAQISLAEELDRTIPVIRALREKFQTVISIDTTRAEVAKEAIAAGADIVNDIS
GATFDAQMLTVVRDLNVPIILMHIRGTPETMQSLTDYQDLIADLKTFFQGRIAAALELGI
PKNHLILDPGIGFAKTALQNYDLIRQLQDFRDLGYPLLVGPSRKSFIGHILNKPDPTQRV
WGTAAACAGAIAFGADILRVHDGPEMIDVAKIADAIWRPTKSAET
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggaaccgcttaccctccggaatcaaacttttacctggggcgatcgcacctatgtgatg
gggattctcaatgtcacccccgacagttttagtgatggcggtcagtttaattccgttgct
gccgccctggcccaagcagaaaaaatggtcgctgctggcattgatattctcgacattggt
ggtcaatcgacccgacccggtgcggcacaaatttccctcgcggaagagttagaccggaca
attcctgtgattcgagcgcttcgagaaaaatttcaaacggtaatttccatcgacaccacc
cgtgcagaagtagcaaaagaggcgatcgccgctggggccgatattgttaatgatatttct
ggggcgacctttgacgcgcaaatgctgacggtggtgcgggatttaaacgtgccaattatt
ttgatgcacatccggggcacacccgaaaccatgcaaagtctgacggactaccaagatctg
attgccgatctgaaaacttttttccaagggcgcatcgctgctgccctagaattgggcatc
ccgaaaaatcacctgatcctcgatccgggcattggttttgcgaaaacagccctgcaaaat
tacgatctcattcgccagctccaggactttcgcgatctgggttacccgctcctggtgggg
ccttcccgtaaaagctttattggccatatcctcaataaaccagatcccacgcaacgggtg
tgggggacagcggcggcctgtgccggggcgatcgccttcggggccgatatcctccgggtg
catgatggcccagaaatgatcgatgtggcgaaaattgccgatgcgatttggcggcctaca
aagagcgcagaaacttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system