KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A1348Help
Entry
SYNPCC7002_A1348  CDS       T00664                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:syp01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:syp00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
1403069..1403959
Genome map
AA seq 296 aa AA seqDB search
MTVQIRRLHPSRPVNVSILQYQVAVPDAKPQHILEEIVWHKEKEVEQLRDKVSLLELRQR
VTTVPPAKDFLGALVHGKTQPALIAEVKKASPSKGVIREDFDPVAIAKSYAAGGASCLSV
LTDNKFFQGSFENLSLVRDAVDLPLLCKEFIIYPYQIFKARSHGADAVLLIAAILSDQDL
AYFVKIIRSLGMTALVEVHTLAELDRVLAIEGVSLVGINNRNLEDFSVDLETTTILLESR
RAELQAKGVRVVSESGLHTPLDLQFVKEAGAKAVLIGESLVKQLDPGKAIADLFQF
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgcaaatccgtcgtctccaccccagccgtcccgttaacgtcagcatcttgcag
taccaagtggcggtgcccgatgccaaaccccagcatatcctggaagaaattgtttggcat
aaagaaaaagaagtggagcaactacgcgataaggtttctctgctagagctacgtcagcgg
gtcacaacggtgccgcctgcaaaagattttctgggggccttagtccatgggaagacccag
ccagccctcatcgctgaagtaaaaaaagcctcgcctagtaagggggtaattcgggaagat
tttgaccctgtggcgatcgccaaaagttatgccgccgggggagccagttgcctctcagtc
ctcaccgataacaagtttttccagggcagcttcgaaaacctgagcctcgtgcgcgatgcg
gtggatctgcccctgctctgcaaagaatttattatttatccctatcaaatctttaaggcc
cgcagccatggtgccgatgcggttcttttgatcgccgcgatcctcagtgaccaagacctc
gcctatttcgtcaaaattatccgcagcttagggatgaccgccctggtggaagtccatacc
ctcgcggaacttgatcgcgtcctcgccattgagggggtgagcctcgtggggattaataac
cgtaacctcgaagatttttccgtcgatttggaaacaaccaccatattgctggaaagtcgt
cgcgccgaactccaggctaagggtgtccgcgttgtcagcgagtcaggcttgcatacgccc
ctggatctccagtttgtcaaagaagccggagcaaaggcagtgttaatcggcgaatctctc
gtgaaacagctggatcctgggaaggcgatcgccgacttatttcagttttag

DBGET integrated database retrieval system