KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A1402Help
Entry
SYNPCC7002_A1402  CDS       T00664                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SYNPCC7002_A1402 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SYNPCC7002_A1402 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SYNPCC7002_A1402 (thrC)
Enzymes [BR:syp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SYNPCC7002_A1402 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
1469288..1470403
Genome map
AA seq 371 aa AA seqDB search
MVLSTPKADPTSAPFPTHHAAKWPGLINAYRQYLPVTDSTPVVTLYEGNTPLIPIPSIAA
EIGRGVQVYAKYDGLNPTGSFKDRGMTMAITKAKEAGAEAVICASTGNTSAAAAAYARRA
GLRAFVLIPDGYVALGKLAQALLYGAEVIAIEGNFDNALSIVRQMSENYPVTLVNSVNPY
RLQGQKTAAFEVVDALGEAPDWLCIPVGNAGNITAYWMGFCEYHELNKATKLPRMMGFQA
SGAAPFIQGGPVHNPETLATAIRIGNPVNWDKAHGVQAASQGAFNAVTDEEIIEAYRKLG
ANEGIFCEPASAASVAGLLKVKDQVPTGATVVCVLTGNGLKDPDAAIAHSLSKGQTGIPA
NMAAVAKAMGF
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtggttctgagtactcctaaagccgatccgacctctgctccctttccgacccaccatgct
gctaagtggccgggtctgattaacgcgtatcgccaatatctccccgtaaccgacagcacc
cccgtggtgaccctctacgaaggcaatactcccctgattcccattcccagtattgccgca
gaaatcggtcgtggggtgcaagtctatgccaaatatgacggcctaaatcccacggggagc
tttaaagaccggggcatgaccatggcaattaccaaagccaaggaagcaggggccgaagcc
gtaatttgtgcgagtactggtaacacatctgctgctgctgctgcctatgctagacgggca
ggtctaagggcgtttgtcttaattcccgatggttatgtggccctaggaaaattagcccag
gctttgttatacggggctgaagtgatcgccattgaaggcaactttgataacgccctcagc
atcgtgcgacaaatgtcggaaaattaccctgtaacactggtcaattctgtgaatccctac
cggctccagggtcaaaaaaccgcagcatttgaggtagtcgatgccctcggtgaagcgccg
gattggctttgtattcctgtaggcaatgcagggaatatcacagcctattggatgggattt
tgtgaataccatgaactaaataaagcgacgaagctcccccgcatgatgggcttccaagcg
tctggtgcggcaccgtttatccagggagggcctgtccataacccggaaaccctggcaacg
gcaattcgcattggcaacccggtaaactgggacaaagcccacggggtgcaagcggctagc
caaggggcttttaatgcggtgaccgacgaagaaattatcgaggcttatcgcaagcttggg
gctaacgaaggaattttctgtgaacctgccagtgcagcctcggtggccggacttttgaaa
gtcaaagatcaagtgccaacgggagcaacggtagtttgtgttctgacaggtaatggtttg
aaggatcccgatgcggcgatcgcccacagtttatcaaaagggcaaaccggaattcctgca
aatatggcagcggtggctaaggcaatgggattctag

DBGET integrated database retrieval system