KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A1744Help
Entry
SYNPCC7002_A1744  CDS       T00664                                 

Gene name
recR
Definition
recombination protein
Orthology
K06187  
recombination protein RecR
Organism
syp  Synechococcus sp. PCC7002
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:syp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SYNPCC7002_A1744 (recR)
DNA repair and recombination proteins [BR:syp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SYNPCC7002_A1744 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
1831517..1832086
Genome map
AA seq 189 aa AA seqDB search
MIEQFQRLPGIGPKTAQRLALYVIKRPEKDVEAFAQALLNAKKQVGVCQKCFHLSATSVC
DICRNPQREPDVICVVADSRDVIALEKTREYRGKYHVLGGVISPMDGIGPEQLTIQALVQ
RVSAEKTKEVILAINPSVEGETTTLYLAQLLRPFTKVTRIAFGLPMGGDLEYADEVTLAR
ALEGRRELD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttgatcgaacagttccagcgcttacccggtattggcccgaaaaccgcccaacgccttgcc
ctatacgtcatcaagcgcccggaaaaggatgtggaagcctttgcccaggcactattgaac
gcgaaaaaacaggtgggcgtttgccaaaaatgtttccatctgtcggccacttcggtttgt
gatatttgtcgcaatccccaacgggagccagacgtaatttgtgtggtggcggactccagg
gatgtgatcgccctcgaaaaaacccgggaatatcggggaaaatatcacgtcctggggggc
gtaatttcgccgatggatggcattggcccggagcaactgacaatccaggccctagtacaa
cgggtaagcgctgagaaaaccaaggaagtgattttagcgatcaatcccagtgtagaaggg
gaaacgacgacgttgtacctggcgcaactgctgcgaccctttactaaagttacccgcatt
gcctttggcttgcccatgggcggtgatttggaatatgccgatgaagtcactttggccagg
gccttagaaggtcgccgggaactagattaa

DBGET integrated database retrieval system