KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A1751Help
Entry
SYNPCC7002_A1751  CDS       T00664                                 

Definition
arginase/agmatinase family protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SYNPCC7002_A1751
Enzymes [BR:syp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SYNPCC7002_A1751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
1836661..1837833
Genome map
AA seq 390 aa AA seqDB search
MSEQPNFRPPSEAQAALEKESHLPLTGWQQEVDRGLEYGLEAAASIKDRSIPTFSRGELP
HYAGINTFLKAPYLEDVRKVGEYDVAILGVPHDSGTTYRPGTRFGPQGIRRISALYTPYN
FEMGIDLREQITLCDVGDVFTIPANNEKSFDQISKGVAHVFSSGAFPIILGGDHSIGFPT
VRGVCRHLGDKKVGIIHFDRHVDTQETDLDERMHTCPWFHATNMANAPAKNLVQLGIGGW
QVPRQGVKVCRERATNILTVTDITEMGIDAAAEFALERALDGTDCVYISFDIDCIDAGFV
PGTGWPEPGGLLPREALALLGKIVRKAPVCGLEIVEVSPPYDISDITSLMATRVICDTMA
HLVLSGQLPRKEKPAYIHPEANMAVDQAWT
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacaaccgaattttcgtccccccagtgaagcccaagcagccctcgaaaaagaa
tctcacctccccctcaccggttggcaacaggaagtagaccggggcctggaatacggcctc
gaagccgccgccagtatcaaagaccgcagcattcccaccttttcccgaggagaactgccc
cactatgccgggatcaatactttcctaaaggccccttatctcgaagatgtccgcaaggtt
ggtgaatatgacgtggccatccttggcgtcccccacgactctggcaccacctatcgcccc
ggcactcgctttggcccccaggggattcggcggatctcggctctctataccccctacaac
tttgagatgggcattgatctgcgggagcaaattaccctttgtgatgtgggggatgtcttt
acgattccggccaataacgaaaaatcctttgatcaaatttctaaaggggtcgcccatgtg
tttagttccggtgctttcccgattattctcggcggcgaccattccattggctttcccacg
gtgcggggggtttgtcggcatttaggcgataaaaaagtaggcattattcactttgaccgc
catgtggatacccaggaaacagatttagacgagcggatgcacacctgtccttggttccat
gccaccaatatggccaatgctcccgccaaaaatctggtgcagttggggattggcggttgg
caggtgccccggcaaggggtcaaggtttgtcgagaacgggcgaccaatattctcacggtg
actgatattaccgaaatgggtatcgatgcggcggcggagtttgccctggagcgtgcccta
gatggtaccgattgtgtttacatcagctttgacattgactgcattgatgcgggatttgtc
cccggcacaggttggccagaaccaggcggtttattgcccagggaagccctcgctctcctc
ggtaaaatcgtccggaaggcccccgtctgtggtttggaaatcgtcgaagtttcaccgccc
tacgacattagcgatatcacgtccctgatggcgacccgcgtgatttgtgataccatggcc
cacctcgttttatctggtcagctaccccgcaaagaaaagcccgcctacattcaccccgaa
gcaaatatggcagtggatcaggcttggacttaa

DBGET integrated database retrieval system