KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A1751Help
Entry
SYNPCC7002_A1751  CDS       T00664                                 

Definition
arginase/agmatinase family protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:syp00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
1836661..1837833
Genome map
AA seq 390 aa AA seqDB search
MSEQPNFRPPSEAQAALEKESHLPLTGWQQEVDRGLEYGLEAAASIKDRSIPTFSRGELP
HYAGINTFLKAPYLEDVRKVGEYDVAILGVPHDSGTTYRPGTRFGPQGIRRISALYTPYN
FEMGIDLREQITLCDVGDVFTIPANNEKSFDQISKGVAHVFSSGAFPIILGGDHSIGFPT
VRGVCRHLGDKKVGIIHFDRHVDTQETDLDERMHTCPWFHATNMANAPAKNLVQLGIGGW
QVPRQGVKVCRERATNILTVTDITEMGIDAAAEFALERALDGTDCVYISFDIDCIDAGFV
PGTGWPEPGGLLPREALALLGKIVRKAPVCGLEIVEVSPPYDISDITSLMATRVICDTMA
HLVLSGQLPRKEKPAYIHPEANMAVDQAWT
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacaaccgaattttcgtccccccagtgaagcccaagcagccctcgaaaaagaa
tctcacctccccctcaccggttggcaacaggaagtagaccggggcctggaatacggcctc
gaagccgccgccagtatcaaagaccgcagcattcccaccttttcccgaggagaactgccc
cactatgccgggatcaatactttcctaaaggccccttatctcgaagatgtccgcaaggtt
ggtgaatatgacgtggccatccttggcgtcccccacgactctggcaccacctatcgcccc
ggcactcgctttggcccccaggggattcggcggatctcggctctctataccccctacaac
tttgagatgggcattgatctgcgggagcaaattaccctttgtgatgtgggggatgtcttt
acgattccggccaataacgaaaaatcctttgatcaaatttctaaaggggtcgcccatgtg
tttagttccggtgctttcccgattattctcggcggcgaccattccattggctttcccacg
gtgcggggggtttgtcggcatttaggcgataaaaaagtaggcattattcactttgaccgc
catgtggatacccaggaaacagatttagacgagcggatgcacacctgtccttggttccat
gccaccaatatggccaatgctcccgccaaaaatctggtgcagttggggattggcggttgg
caggtgccccggcaaggggtcaaggtttgtcgagaacgggcgaccaatattctcacggtg
actgatattaccgaaatgggtatcgatgcggcggcggagtttgccctggagcgtgcccta
gatggtaccgattgtgtttacatcagctttgacattgactgcattgatgcgggatttgtc
cccggcacaggttggccagaaccaggcggtttattgcccagggaagccctcgctctcctc
ggtaaaatcgtccggaaggcccccgtctgtggtttggaaatcgtcgaagtttcaccgccc
tacgacattagcgatatcacgtccctgatggcgacccgcgtgatttgtgataccatggcc
cacctcgttttatctggtcagctaccccgcaaagaaaagcccgcctacattcaccccgaa
gcaaatatggcagtggatcaggcttggacttaa

DBGET integrated database retrieval system