KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A1782Help
Entry
SYNPCC7002_A1782  CDS       T00664                                 

Gene name
proB
Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SYNPCC7002_A1782 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SYNPCC7002_A1782 (proB)
Enzymes [BR:syp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SYNPCC7002_A1782 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
complement(1867289..1868413)
Genome map
AA seq 374 aa AA seqDB search
MPQTIVVKIGTSSLTDPKTGMLALATIGTLVETLTRLKQKGHRVILVSSGAVGVGCGVLK
RSERPKKIAEKQAIAAVGQGRLIRLYDDLFTSLQQAIAQVLLTRRDLVDRTSYLTVQEAL
NAMLDLSVIPIVNENDTVAVDELKFGDNDTLSALVASLVNADWLVLLTDVDRLYSADPRQ
NPDARPIPLVSSSELFNLQVDAGSSGSQWGTGGMQTKLTAARIATSAGVRTVITQGKTPQ
NLLKIVAGEDIGTHFEAQPQADNARKRWIAYGLVPQGILTLDDGATQALLKNGRSLLAAG
IVAVEGEFTINDPVELRTQTGQAIARGLVNYNHQDIEKIQGQHSTQIRQILGYGSADTVI
HRDNLALLIAAEGI
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgccccaaaccatcgtcgttaaaattggcacctctagcctcacagatcccaagacaggc
atgttggctttggcaactatcggtaccctcgtggaaaccttgacccgcctcaaacaaaag
ggccaccgggtgatcctcgtctcctctggggccgtgggcgtgggctgtggggtgttgaaa
cgttcagaacgcccgaaaaaaattgccgaaaaacaggcgatcgccgccgtgggtcagggg
cgcttaatccggctttatgatgatctatttaccagtctgcaacaggcgatcgcccaggta
ttactcacccgtcgagacctcgtggatcgcacttcctacctgaccgtccaggaagccctc
aacgcgatgttggatctcagcgtgatcccgattgtgaacgaaaacgataccgttgccgtc
gatgaactgaaattcggcgataacgataccctctctgccctggtcgccagcttggtgaat
gccgactggttggtgctactcaccgatgtggatcgcctctattccgctgaccccagacaa
aatcctgacgcccgccctattcccctggtcagttccagcgaactgtttaacctccaagtc
gatgctggatctagcggctcccaatgggggacagggggcatgcaaacaaagctcactgct
gctcgcattgccaccagcgctggcgtacgcacggtgattacccagggcaaaaccccccag
aatctcctgaaaattgttgctggggaagatatcggcacccattttgaagcccaaccccag
gccgataatgcccgtaaacgttggattgcctatggccttgtaccccagggaattctcacc
cttgacgatggcgcaacccaggctctcctgaaaaatggtcgttctctccttgcggcaggt
attgttgccgtggaaggagaatttaccattaacgaccccgtagaactgagaacccaaaca
ggtcaggcgatcgccagagggttagtaaactacaaccaccaagatattgaaaaaattcaa
gggcaacattcgacccaaattcgccaaattctcggctacggcagcgccgacaccgtgatt
caccgagataacttggccctgctgatcgccgctgaagggatatga

DBGET integrated database retrieval system