KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A1846Help
Entry
SYNPCC7002_A1846  CDS       T00664                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SYNPCC7002_A1846 (gmk)
Enzymes [BR:syp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SYNPCC7002_A1846 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
1935874..1936428
Genome map
AA seq 184 aa AA seqDB search
MTTPGKLIVLTGPSGVGKGTLVRSLLPRHQNLFLSISATTRQPRPGEVDGQDYFFKTREQ
FEAMIAAGDLLEWAEYAGNYYGTPLPPVKTQIQQGNFVILEIEVIGANQVKEIYADALRI
FILPPSFEELEQRLRGRGNDPEAAIAKRLVRAKEELAMSHEFDHEIVNDDLETALTELEK
VIFS
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccccggaaaattaattgtcctcacagggccaagtggtgttggtaaaggaacc
ttagttcgttctttactaccgcgccaccaaaatttatttctctcgatctcagcaacaacc
cgtcagccccgccctggagaagtggatgggcaagactattttttcaaaacccgtgaacaa
tttgaggcgatgatcgctgcgggggatctcctcgaatgggccgagtatgcgggaaattac
tacggcacccctctgcctccggtgaaaacacaaattcaacagggaaactttgtcatcctc
gaaatcgaggtcattggggccaaccaagttaaagaaatctatgcagatgccctcagaatt
tttattttgccaccgtcctttgaagagttagaacagcggctgcggggacggggtaatgat
ccagaagcggcgatcgccaaacggctcgtccgggcaaaagaagaattggccatgagccat
gagttcgaccatgaaattgtcaatgacgacctagaaacagccttaacagaactcgaaaaa
gtgattttcagctag

DBGET integrated database retrieval system