KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A1846Help
Entry
SYNPCC7002_A1846  CDS       T00664                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
syp  Synechococcus sp. PCC7002
Pathway
syp00230  Purine metabolism
syp01100  Metabolic pathways
Module
syp_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SYNPCC7002_A1846 (gmk)
Enzymes [BR:syp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SYNPCC7002_A1846 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 RsgA_GTPase AAA_22 AAA_33 AAA_16 MMR_HSR1 ABC_tran AAA_29 cobW AAA AAA_28 NTPase_1 TsaE IcmF-related AAA_24
Motif
Other DBs
NCBI-ProteinID: ACA99834
CyanoBase: SYNPCC7002_A1846
CYORF: SYNPCC7002_A1846
UniProt: B1XQ52
Position
1935874..1936428
Genome map
AA seq 184 aa AA seqDB search
MTTPGKLIVLTGPSGVGKGTLVRSLLPRHQNLFLSISATTRQPRPGEVDGQDYFFKTREQ
FEAMIAAGDLLEWAEYAGNYYGTPLPPVKTQIQQGNFVILEIEVIGANQVKEIYADALRI
FILPPSFEELEQRLRGRGNDPEAAIAKRLVRAKEELAMSHEFDHEIVNDDLETALTELEK
VIFS
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccccggaaaattaattgtcctcacagggccaagtggtgttggtaaaggaacc
ttagttcgttctttactaccgcgccaccaaaatttatttctctcgatctcagcaacaacc
cgtcagccccgccctggagaagtggatgggcaagactattttttcaaaacccgtgaacaa
tttgaggcgatgatcgctgcgggggatctcctcgaatgggccgagtatgcgggaaattac
tacggcacccctctgcctccggtgaaaacacaaattcaacagggaaactttgtcatcctc
gaaatcgaggtcattggggccaaccaagttaaagaaatctatgcagatgccctcagaatt
tttattttgccaccgtcctttgaagagttagaacagcggctgcggggacggggtaatgat
ccagaagcggcgatcgccaaacggctcgtccgggcaaaagaagaattggccatgagccat
gagttcgaccatgaaattgtcaatgacgacctagaaacagccttaacagaactcgaaaaa
gtgattttcagctag

DBGET integrated database retrieval system