KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A1865Help
Entry
SYNPCC7002_A1865  CDS       T00664                                 

Gene name
glgB
Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SYNPCC7002_A1865 (glgB)
Enzymes [BR:syp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SYNPCC7002_A1865 (glgB)
Exosome [BR:syp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SYNPCC7002_A1865 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
1955720..1958053
Genome map
AA seq 777 aa AA seqDB search
MPTLLTPDQINQIVSNHHDNPHAVLGCHPTNDDPNPKTWSIRAYLPSASQAWVIDTPSQT
EHPMTTVHHPHFFECTLQSETTPKYQLKLQEGDRQHIINDPYAFAEAPHISDLDLHLFAE
GNHHRIYNKLGAHLVEVDGIKGVYFAVWAPNARNVSILGDFNNWDGRKHQMRRLNVGIWG
IFIPDLGPNTKYKYEIKNQHGHIYEKSDPYGFLREVRPDTASIVADLDQYQWQDHDWLEQ
RAKQDPLKNPVSIYELHLGSWLHGSATEKMQLLSGEVDPIPVGDQKPGARFLSYYELVDK
LIPYVKDMGYTHIELLPVAEHPFDGSWGYQVTGYYSPTSRFGNPEDLMYFIDQCHANGIG
VIVDWVPGHFPKDAHGLAYFDGTHLYEHADPRKGEHKGWGTLIFNYNRNEVRNFLIANAL
FWFDKYHIDGIRVDAVASMLYLDYDREDGEWLPNDYGGNEHLEAVEFLRQTNNLIFKYYP
GIISVAEESTAWPMVSRPTYLGGLGFNLKWNMGWMHDNLKYFSMDPWFRQHHQNSITFSM
WYHHSENYMLALSHDEVVHGKSSIIGKMPGDEWQKFANVRALFAYMFTHPGKKTMFMSME
FGQWNEWNVWSDLSWDLLQHEPHAKLKGFFGALNSLYKQEPALYERDFEEEGFQWIDCSD
NQNSVLSFIRRAKDPNDFLVVVCNFTPQPHSHYRIGIPEEGYYQEILNSDAETFGGSNLL
NFGGVWTEDWRFHNLPYSIDLCLPPLGVVVLKIDREKTAAMLAQKQADKAKALSGEI
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atgcctactctcctcactccagaccagatcaaccaaattgtttctaaccaccatgacaac
ccccatgctgtcttgggttgtcatcccaccaacgacgatcccaatccgaaaacctggtca
attcgcgcttatttaccttctgctagccaagcttgggtgattgataccccttcccaaacg
gaacacccgatgacaacggtgcatcatccccacttttttgaatgcaccctccagagtgaa
acaacaccgaaatatcaactgaagctccaagaaggcgatcgccaacacatcatcaacgat
ccctatgcctttgccgaagccccccacattagcgatctcgatctccacctctttgccgaa
gggaatcaccaccgcatctacaacaaactgggggcacacctcgtcgaagtcgatggcatc
aaaggcgtttactttgccgtttgggcgcccaatgcccgcaacgtctccatcctgggcgac
tttaacaactgggatggtcgcaaacaccaaatgcgccgtttaaacgttggtatctgggga
attttcattcctgacctcggccccaacaccaaatacaaatacgaaatcaaaaaccaacac
ggccacatctacgaaaaatcagacccctacggctttctccgggaagtgcgccccgacact
gcctccatcgttgctgacctcgaccagtaccaatggcaggatcacgattggctagaacaa
cgtgccaaacaagaccccctcaaaaatcctgtttccatctacgaactacacctcggctcc
tggctccatggttccgccaccgaaaaaatgcaactcctttccggtgaagtcgatcccatt
cccgtgggcgatcaaaaacccggtgcccgcttcctgagctattacgaactggttgataag
ctcatcccctacgttaaggacatgggctacacccacatcgagctactgcctgtcgctgaa
catccctttgacggttcctggggctaccaagtgaccggctactattcccccacttcccgc
tttggcaatcccgaagacctgatgtatttcatcgatcaatgccacgccaatggtatcggg
gtgatcgttgactgggttcctggccatttccctaaggatgcccatggtctcgcttacttc
gatggcacccatctctatgaacacgccgatccccgcaaaggtgagcacaaaggctggggc
accctgatctttaactacaatcgcaatgaggttcgcaacttcctcattgccaatgcccta
ttctggtttgataaatatcacatcgatggcattcgggtcgatgcagtggcatcaatgctc
tacctcgactacgaccgggaagatggcgagtggcttcccaatgactacggcggcaacgaa
cacctcgaagccgtagaatttctccgccaaaccaacaatctcatcttcaagtactatcca
gggattatctccgttgccgaagagtccacggcttggcccatggtttctcgtcccacttac
ctcggtggcctcggcttcaacctcaagtggaatatgggctggatgcacgacaatctcaaa
tacttcagcatggatccctggttccggcagcaccaccaaaacagcattaccttcagtatg
tggtatcatcacagcgagaactacatgttggccctttcccacgatgaagtcgtccatggt
aagagctcgattattggcaaaatgccgggggatgaatggcagaaatttgccaatgtgcgg
gctttattcgcctatatgtttacccatcctggtaaaaagaccatgtttatgagcatggaa
tttggccaatggaatgagtggaatgtttggagtgacttgagttgggatttactgcaacat
gaaccccacgccaaactcaaaggtttcttcggggcattaaatagtctctataaacaggaa
ccggccctttacgaacgggattttgaagaggaaggattccaatggattgactgttctgac
aatcaaaatagtgttctttcctttattcgacgggcaaaagatcccaatgattttttagtt
gtggtctgcaattttacgccgcaaccccatagccattatcgaattggcattccagaagag
ggctactatcaagaaattttgaatagtgatgccgaaacctttggggggagtaatctactc
aacttcggcggcgtttggactgaagattggcgcttccataatcttccctattccattgat
ctgtgtttgccgcccctcggcgtggttgtcctaaaaattgatcgagaaaaaacagccgca
atgcttgctcaaaaacaggccgataaagccaaggctctatccggcgaaatataa

DBGET integrated database retrieval system