KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A1989Help
Entry
SYNPCC7002_A1989  CDS       T00664                                 

Gene name
desF
Definition
syn-2, delta 9 acyl-lipid fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:syp01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:syp01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
complement(2070390..2071232)
Genome map
AA seq 280 aa AA seqDB search
MTQSVQHPTQKPTLDWVAVFFFGAVHLLALGLAPFFFSWSAIAVCLFLHWLFGSIGICLG
YHRLLSHRSLKVPQWLEYTLAFIGALALQGGPIFWVAGHRLHHAHTEDEVKDPYSAKRGF
WWSHMLWIFYPDQQFFDADQYSRYAQDLAKQPFYRWLNRNFLLLQIPLAIALYLLGGWSW
VVYGMLVRAVLLWHSTWFINSVTHVWGYRSHASDDNSRNLWWAAILTYGEGWHNNHHAYP
SVAKAGWRWWEIDVTWWAIWLLQRLGLATKVILPPAVVTE
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgacccaatctgtgcaacaccccacccaaaaaccgaccctagactgggttgccgtgttc
ttttttggcgcggttcatctcctggcccttggtttggcccccttctttttctcttggtcg
gcgatcgccgtttgtctgtttctccactggctctttggcagtattggcatttgtttgggc
taccatcgcctgttgagccaccgcagcctcaaagtcccgcaatggctggaatataccctg
gcgtttattggtgcccttgccctccagggtggccctattttttgggtggcgggccaccgg
ctgcaccatgcccacacggaagatgaagttaaagacccctattccgccaaacggggtttt
tggtggagccatatgctctggattttctaccccgatcaacaattttttgatgctgaccaa
tacagccgctatgcccaggatctcgcgaaacagcccttttaccgttggctaaaccgcaat
tttctgttgctacaaattcctttggcgatcgccctttatctcctcggcggttggtcttgg
gtcgtgtatgggatgctggtgcgggcggtgttgctatggcatagcacctggtttatcaac
tctgtcacccatgtgtggggctaccgcagtcacgcaagcgacgataattcccgtaatctc
tggtgggcggcaattctcacctatggcgaaggctggcataacaaccaccatgcctatccc
agtgtggcgaaagccggttggcgctggtgggaaatcgatgttacctggtgggccatctgg
ctcctacaacggcttggtctcgccacgaaagtcattttgccgccagccgtcgtcacagaa
taa

DBGET integrated database retrieval system