KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A2022Help
Entry
SYNPCC7002_A2022  CDS       T00664                                 

Definition
putative sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SYNPCC7002_A2022
Enzymes [BR:syp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     SYNPCC7002_A2022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
2102401..2104155
Genome map
AA seq 584 aa AA seqDB search
MTIPQIAGLGDRLDEFFATLYPDHPPAALVARLEQVLAPHVTATKNEELWDQSTALMITY
GDSLYQPNTDNGPNPLQVLLTFLRERLQGVISGVHILPFFPYSSDDGFAVIDYRQVNPQL
GSWQDIEAIAKEFEVMADLVINHVSSESDWFRQFLAQEKPGCDYFIEVPPDTDTQLVVRP
RSSPLLSQFATTKGDRHVWTTFSRDQVDVNFANPDVLFEFIDILLGYCQHGIRFIRLDAV
GFLWKKLQTACIHLRETHLVIQLIREILAVTYPRTVVITETNVPNRENLSYFGKGNEAHM
IYNFSLPPLLLNALIRGEARHLKTWMKSMPPAQDGCAYFNFTASHDGIGLRPAEGLLEGK
EFDQLIQTMADFGARISYRSLPNGTEKPYELNISLFDALKGTVTGPDPWQRQRFLCSQAI
MMSLEGVPAFYIHSFLATPNDDAKVAMTNHNRSINRHQWDDDRLQQKLADPDSDQAWVLQ
ELTKLIRIRRQQPAFHPNATQYTLDFQSPAVFGFWRQSRDRRQSIFCLFNLGDRPTTIPV
ASLNLICTDDWQDLLDEVVLEEGTTDISLAPYQTAWITNVPLLY
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgaccattccccagattgcaggtcttggcgatcgccttgatgaattttttgcgacccta
tatcctgatcatccgcctgcagcattagttgcgcgtttggagcaggtacttgcgccccat
gtgacggcgacgaaaaatgaagagttatgggatcaaagcacggccctgatgattacctac
ggggatagcctgtaccaacccaatactgacaatggccccaaccccctccaggtacttttg
acttttctgcgggaacggctccagggagtgattagcggtgtgcatattctgccgtttttt
ccctacagttccgatgatggctttgcggtaattgattaccgccaggtcaatccgcagttg
ggcagttggcaagatatcgaggcgatcgccaaagaatttgaagtgatggccgatctggtg
atcaaccatgtctcaagtgaatcagactggtttcggcaattcctcgcccaggaaaaaccc
ggttgtgactacttcattgaggtgcccccagataccgatacccagttagtggtgcgcccc
cgcagtagcccgctcctgagtcaatttgccacgacaaaaggcgatcgccacgtgtggacc
acctttagccgcgatcaagtagatgtcaactttgctaaccccgacgtcctctttgaattt
atcgatatcctcttgggttactgtcagcacggcatccgctttattcgccttgatgcggtg
ggctttctctggaaaaaattacaaaccgcctgcattcacctgcgggaaacccatctggtg
atccaattgatccgggaaatccttgctgtcacctacccacgcaccgtggtgattaccgaa
accaacgtccccaaccgggaaaacctcagctatttcggcaagggcaacgaggcccacatg
atctacaatttcagcctgccgcccctactcctcaatgcgctgattcggggcgaagcccgg
cacctcaaaacctggatgaaaagtatgcccccggcccaggatggttgcgcctactttaat
ttcaccgcctcccacgatggcattggcctccgccccgccgaaggtctgctagaaggcaaa
gaattcgatcaattgatccaaaccatggccgattttggggccagaattagctaccgtagt
ttgcccaatggcaccgaaaaaccctatgaactgaatatttctttgttcgatgccctcaaa
ggcacagttacaggccccgatccttggcaacggcaacgattcctctgttcccaggcgatc
atgatgtccttagagggagtgcccgctttctatatccatagttttttggcgacccccaat
gatgacgccaaggtggcgatgacaaaccataaccgcagcattaaccgtcaccaatgggac
gatgaccgactccagcaaaagctcgctgaccctgattctgaccaagcctgggtgttgcaa
gaactgacaaaactcatccggatccgtcgccagcaaccggcatttcatcccaacgcgacc
caatacacccttgatttccagagtccggcagtctttgggttttggcgtcagagccgcgat
cgccgccagagtattttctgcttgtttaacctaggcgatcgcccgacaaccatcccggtg
gccagcttaaacctgatttgcaccgatgactggcaggatttattagatgaagttgtgtta
gaagaaggcacaacggacatttccctagccccctatcaaactgcgtggattaccaatgtt
cctctgctttactga

DBGET integrated database retrieval system