KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A2256Help
Entry
SYNPCC7002_A2256  CDS       T00664                                 

Gene name
chlI
Definition
(GenBank) magnesium chelatase ATPase subunit I
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
syp  Synechococcus sp. PCC7002
Pathway
syp00860  Porphyrin and chlorophyll metabolism
syp01100  Metabolic pathways
syp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SYNPCC7002_A2256 (chlI)
Enzymes [BR:syp01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     SYNPCC7002_A2256 (chlI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 AAA_22 AAA_16 MCM Sigma54_activat AAA_29 AAA ABC_tran AAA_18 DUF815 AAA_27 RNA_helicase FtsK_SpoIIIE AAA_30 AAA_28 tRNA_lig_kinase MMR_HSR1 AAA_23
Motif
Other DBs
NCBI-ProteinID: ACB00235
CyanoBase: SYNPCC7002_A2256
CYORF: SYNPCC7002_A2256
UniProt: B1XJ69
Position
complement(2338505..2339587)
Genome map
AA seq 360 aa AA seqDB search
MTVTAEAPPQEKVKRRVVFPFTAVIGQDEMKLALKLNIIDPKIGGVMIMGDRGTGKSTTI
RALADLLPEIEVVANDPFNSDPKNPELMGDEVRQKLENNEPIEVARKKVPMIDLPLGATE
DRVCGTIDIEKALSEGVKAFEPGLLAKANRGVLYVDEVNLLDDHLVDVLLDSAAGGWNTV
EREGISIRHPASFVLVGSGNPEEGELRPQLLDRFGMHAEIRTERNPEQRVEIVERRSAFD
QNPTEFLQQYDAEQKAEQERLVRAQELLPQVTIDRELKVKISEVCSEADVDGLRGDIVTN
RAAKALAAYEGRTEVTVDDIRRVVTLCLRHRLRKDPLESIDSGYKVQKIVARVFGLEEDE
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgacagtaacggctgaagctcctccccaagaaaaagtaaaacgtcgtgtggtgttcccc
tttacggcggtaatcggccaagatgaaatgaaactggccctcaaactcaacatcatcgac
cccaagatcggcggcgtgatgatcatgggcgatcgcggtaccggaaaatccaccaccatc
cgtgctttagccgatctcctgcccgaaatcgaagtggttgccaacgatccctttaacagc
gaccccaaaaaccctgaactcatgggcgatgaagtgcggcaaaaactcgaaaacaacgaa
ccaatcgaagtcgcccgcaaaaaagtgccgatgattgacctgcccctcggcgcaacagaa
gaccgggtttgtggcaccatcgacatcgaaaaagccctctccgaaggggtaaaagccttt
gaaccgggtcttttggcaaaagcaaaccggggtgtcctctatgtggatgaagttaacctc
ctcgatgatcacctggtagacgttctcctcgactccgccgctggcggttggaataccgtt
gaacgggaagggatttccattcgtcaccctgccagttttgtccttgtcggttccggcaac
cccgaagaaggagaactgcggccccaacttctcgaccgtttcgggatgcacgctgagatc
cgcaccgaacgcaatcccgaacagcgcgttgaaattgtcgaacgtcgttcggcctttgac
caaaatcccacagaatttctgcaacaatacgacgccgagcaaaaagcagaacaggaacgc
cttgtccgcgcccaggaacttttaccccaggtcaccattgatcgagaactaaaggtgaag
atctccgaagtttgttccgaagcggatgtggatggtctccggggtgatatcgtcaccaac
cgcgccgccaaagccctcgccgcctatgaaggccgcaccgaagtgaccgtggatgatatt
cgccgggtggttaccctttgtctgcgacaccgtctgcggaaagatccccttgaatcaatt
gattctggctataaggttcagaaaattgtcgcccgcgtctttggtctagaagaagacgag
taa

DBGET integrated database retrieval system