KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A2416Help
Entry
SYNPCC7002_A2416  CDS       T00664                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
syp  Synechococcus sp. PCC7002
Pathway
syp00900  Terpenoid backbone biosynthesis
syp01100  Metabolic pathways
syp01110  Biosynthesis of secondary metabolites
syp01130  Biosynthesis of antibiotics
Module
syp_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SYNPCC7002_A2416 (ispE)
Enzymes [BR:syp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SYNPCC7002_A2416 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N NMT1_2
Motif
Other DBs
NCBI-ProteinID: ACB00394
CyanoBase: SYNPCC7002_A2416
CYORF: SYNPCC7002_A2416
UniProt: B1XK39
Position
2503213..2504163
Genome map
AA seq 316 aa AA seqDB search
MSAYLLTAPAKINLYLEILGDRPDGFHELVMVMQTIGLYDRIEVRQNRSGDINLYCQHPE
VPLTASNIAYRAAQLMMTRFADIYARVGGGVDITIEKNIPVAAGLAGGSTDGAAVLVGLN
LLWDLGLTQPELQTLAAELGSDVPFCIGGGTVIATGRGEILDPLPDLDGIPIVLAKYSNI
AVSTPWAYQTYRAQFGEHYLQDAASWRTRMTQIHAGGLIKAIQQKNIQAIAHELHNDLEK
VVLPEFPQVQQLRDCFTKHGAIGTMMSGSGPSVFALCETLAQAQALKVQVAQELNDPALD
LWVTHIASPGIQADFR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcctatcttctgactgcccccgcaaaaattaatctctacctcgaaattttgggc
gatcgccccgacgggttccacgagttggtgatggtgatgcagaccattggcttatatgac
cggattgaggtgcgacaaaaccgtagcggcgacatcaatctctattgccagcatcccgaa
gtccccctcaccgctagcaatattgcctaccgagccgcccagttaatgatgacgcgcttt
gcagatatctacgccagggtgggtggtggagttgacattaccatcgaaaaaaatatcccc
gtggcggcgggactggctggggggtcaacggatggcgcagcggtattggtggggttgaat
ttgctctgggatttagggttaacccaaccggaattacaaaccttagcagcagaactgggt
tcggatgtgcccttttgcattggtggggggacggtgatcgccaccggacggggagaaatt
ttagacccattgcccgatctcgatggcatcccgattgtcctcgcaaagtacagcaacatt
gctgtttctaccccctgggcctaccaaacctaccgcgcccaatttggggagcattatctc
caagatgcggcgagttggcgtacccgcatgacacaaatccatgctggcggcctgatcaaa
gccattcagcaaaaaaatatccaggcgatcgcccatgaactccataacgatctcgaaaaa
gtcgttttacccgaatttccccaggtgcaacaactgcgtgactgctttaccaaacacggg
gcgatcggcacgatgatgtcgggctccggccccagtgtgtttgccctctgcgagaccctc
gcccaagcccaagccctcaaagtccaagttgcccaagaattaaacgacccagccctcgat
ctttgggtgacgcacattgccagccccggcatccaagcggacttccgttaa

DBGET integrated database retrieval system