KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A2438Help
Entry
SYNPCC7002_A2438  CDS       T00664                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SYNPCC7002_A2438 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYNPCC7002_A2438 (glk)
   00052 Galactose metabolism
    SYNPCC7002_A2438 (glk)
   00500 Starch and sucrose metabolism
    SYNPCC7002_A2438 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    SYNPCC7002_A2438 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SYNPCC7002_A2438 (glk)
   00524 Butirosin and neomycin biosynthesis
    SYNPCC7002_A2438 (glk)
Enzymes [BR:syp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SYNPCC7002_A2438 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
2531717..2532616
Genome map
AA seq 299 aa AA seqDB search
MSTVIGIDLGGTAIKGGKFSPDGLCLAEKAVPTPQPSTPTAVAEAIANLVKELNSDHSCK
AVGIGIPGPVDGTARIAKVAINLSGWQDVPLADWVEAKTGLPTTLNNDANCAGLGEAWLG
AGRDRQNLLLITLGTGVGGAVILNGKLFTGHYGAAGELGLITLNPDGPPCNSGNNGSFEQ
YCSINGVKRISGKDPGELGELAQAGDAEAIAHWQTYGKLLGAGLTSLIYIFTPEMIILGG
GISASSDFFIPAAIAEIERRVLPSSRVDLKLTKAQLGNNAGMVGAAKLALEKILNTLDN
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagtgattgggattgatctggggggtacggccatcaaagggggaaaatttagc
cctgatggtctttgtttagcggaaaaagcagtacctacgccccaacccagtaccccaacc
gctgtcgccgaggcgatcgccaatttagtcaaggaacttaactcagatcacagttgtaaa
gcagtggggatcggcattcctggcccggtagatggtacagcgcgcattgccaaggttgcg
atcaatctcagtggttggcaggatgtgcccctcgcggactgggttgaggccaaaaccggt
ttacccacaacgttaaataacgatgccaactgtgccggcctgggggaagcttggttagga
gcggggcgcgatcgccaaaatctcctgctcattaccctaggaacgggagtcggtggggcg
gtaatcctcaacggaaaactttttacgggccattacggtgccgctggcgagttgggcctg
attaccctcaatcccgatggccccccctgcaatagtggtaataatggttccttcgagcaa
tattgttcgatcaatggcgttaagcggatttctggtaaagaccctggggaattaggagaa
ctggcccaggcgggagatgctgaggcgatcgcccattggcaaacctatggcaaactgttg
ggagctgggctgacaagcttaatctatattttcaccccggagatgattattctggggggc
ggcattagtgccagcagtgactttttcatcccagcggcgatcgccgaaattgaacggcgg
gtgcttccttcctcacgggtggatttaaaactgaccaaggcccagttaggcaacaatgcc
ggtatggtgggcgcagcaaaactcgccctcgaaaaaatcttaaataccctggacaattag

DBGET integrated database retrieval system