KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A2438Help
Entry
SYNPCC7002_A2438  CDS       T00664                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:syp01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:syp00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:syp00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:syp00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:syp00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:syp00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
2531717..2532616
Genome map
AA seq 299 aa AA seqDB search
MSTVIGIDLGGTAIKGGKFSPDGLCLAEKAVPTPQPSTPTAVAEAIANLVKELNSDHSCK
AVGIGIPGPVDGTARIAKVAINLSGWQDVPLADWVEAKTGLPTTLNNDANCAGLGEAWLG
AGRDRQNLLLITLGTGVGGAVILNGKLFTGHYGAAGELGLITLNPDGPPCNSGNNGSFEQ
YCSINGVKRISGKDPGELGELAQAGDAEAIAHWQTYGKLLGAGLTSLIYIFTPEMIILGG
GISASSDFFIPAAIAEIERRVLPSSRVDLKLTKAQLGNNAGMVGAAKLALEKILNTLDN
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagtgattgggattgatctggggggtacggccatcaaagggggaaaatttagc
cctgatggtctttgtttagcggaaaaagcagtacctacgccccaacccagtaccccaacc
gctgtcgccgaggcgatcgccaatttagtcaaggaacttaactcagatcacagttgtaaa
gcagtggggatcggcattcctggcccggtagatggtacagcgcgcattgccaaggttgcg
atcaatctcagtggttggcaggatgtgcccctcgcggactgggttgaggccaaaaccggt
ttacccacaacgttaaataacgatgccaactgtgccggcctgggggaagcttggttagga
gcggggcgcgatcgccaaaatctcctgctcattaccctaggaacgggagtcggtggggcg
gtaatcctcaacggaaaactttttacgggccattacggtgccgctggcgagttgggcctg
attaccctcaatcccgatggccccccctgcaatagtggtaataatggttccttcgagcaa
tattgttcgatcaatggcgttaagcggatttctggtaaagaccctggggaattaggagaa
ctggcccaggcgggagatgctgaggcgatcgcccattggcaaacctatggcaaactgttg
ggagctgggctgacaagcttaatctatattttcaccccggagatgattattctggggggc
ggcattagtgccagcagtgactttttcatcccagcggcgatcgccgaaattgaacggcgg
gtgcttccttcctcacgggtggatttaaaactgaccaaggcccagttaggcaacaatgcc
ggtatggtgggcgcagcaaaactcgccctcgaaaaaatcttaaataccctggacaattag

DBGET integrated database retrieval system