KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A2444Help
Entry
SYNPCC7002_A2444  CDS       T00664                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:syp00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
2537855..2538574
Genome map
AA seq 239 aa AA seqDB search
MTTSSSSGFNGSTKTMATDALGRDLNDLVTRPDRNSHNGKAASIRPATEESQQKMAEAVH
TMLEAVGEDPDREGLLKTPLRVAKAMQFLTQGYNQSLEDIVNGAIFDEGHNEMVLVRDID
FFSLCEHHMLPFMGRAHVAYIPNQKVVGLSKLARIVEMYSRRLQVQERLTRQIAEAVQEI
LDPQGVAVVMEGIHMCMSMRGVQKPGSWTVTSAMIGCFQKEQKTREEFLNLIRHQPSFI
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgacaacatcttcttcaagcggcttcaatggttctacaaaaaccatggcgactgatgct
ctaggtcgtgacctcaatgatctggtgactcggccagaccgcaatagccacaatggcaaa
gcagcaagcattcgccctgccacagaagaaagccagcagaaaatggcagaggctgtgcat
acgatgctagaagccgttggcgaagatcctgaccgtgaaggtctcctaaagacgccgctg
cgggtggcaaaagccatgcagtttctgacccaaggctataaccagtcccttgaagacatc
gtcaatggtgcaattttcgatgaagggcacaatgaaatggtattggtgcgggacatcgat
ttctttagcctctgcgaacaccacatgttgccctttatgggtcgggcccacgtggcctat
atcccgaatcagaaagttgtgggcctcagcaaattagcgcggatcgttgaaatgtattcc
cgtcgtctccaggtgcaagaacgtctgacccgacaaattgcagaagcggtccaagaaatc
cttgacccccaaggggttgcggtggtgatggaagggattcacatgtgtatgtccatgcgg
ggtgtccaaaagcccggttcttggacagttaccagtgccatgattgggtgcttccagaaa
gaacaaaaaacccgtgaagagtttctcaacttgattcgtcaccaacccagctttatttaa

DBGET integrated database retrieval system