KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A2561Help
Entry
SYNPCC7002_A2561  CDS       T00664                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SYNPCC7002_A2561 (folK)
Enzymes [BR:syp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SYNPCC7002_A2561 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
2670332..2670859
Genome map
AA seq 175 aa AA seqDB search
MNTGKFFAMERAVDVAIALGSNLGNSLEILENAIKHLSEHPAIALTARSAWYRTAPVGPP
QPDYINGCVTGQVHNLSPEALLEILLKVEQLFGRERRERWGARTLDLDLLLYGQDIIYLP
HLQVPHPRMQERAFVLVPLAEIAPHWCEPRTQQTIQALKEQLPLTGIQRLDSETT
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaatacggggaaatttttcgcaatggaacgggctgtggatgtggcgatcgctcttggg
agtaacctgggcaactccttggaaatcttagaaaatgccattaaacatttaagcgaacat
ccggcgatcgccctaacagctcggtctgcttggtaccgcacggccccggttggccccccg
caaccggactacatcaatggttgcgtcactggtcaggttcataatctcagtcccgaagct
ctcctcgaaatcctgttgaaagtagagcaactgtttggacgggaacggcgggaacgttgg
ggggcacggacgttggatttggatttgcttttgtatggccaggacataatttatctgccc
catttgcaggtgccccacccccggatgcaggaacgggcctttgtgttggtgcccctagca
gagattgcgccccattggtgtgaaccccgcacccaacaaacgatccaagccctcaaggaa
cagcttcccctcactggaattcagagattagacagcgaaactacctaa

DBGET integrated database retrieval system