KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A2561Help
Entry
SYNPCC7002_A2561  CDS       T00664                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:syp00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
2670332..2670859
Genome map
AA seq 175 aa AA seqDB search
MNTGKFFAMERAVDVAIALGSNLGNSLEILENAIKHLSEHPAIALTARSAWYRTAPVGPP
QPDYINGCVTGQVHNLSPEALLEILLKVEQLFGRERRERWGARTLDLDLLLYGQDIIYLP
HLQVPHPRMQERAFVLVPLAEIAPHWCEPRTQQTIQALKEQLPLTGIQRLDSETT
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaatacggggaaatttttcgcaatggaacgggctgtggatgtggcgatcgctcttggg
agtaacctgggcaactccttggaaatcttagaaaatgccattaaacatttaagcgaacat
ccggcgatcgccctaacagctcggtctgcttggtaccgcacggccccggttggccccccg
caaccggactacatcaatggttgcgtcactggtcaggttcataatctcagtcccgaagct
ctcctcgaaatcctgttgaaagtagagcaactgtttggacgggaacggcgggaacgttgg
ggggcacggacgttggatttggatttgcttttgtatggccaggacataatttatctgccc
catttgcaggtgccccacccccggatgcaggaacgggcctttgtgttggtgcccctagca
gagattgcgccccattggtgtgaaccccgcacccaacaaacgatccaagccctcaaggaa
cagcttcccctcactggaattcagagattagacagcgaaactacctaa

DBGET integrated database retrieval system