KEGG   Synechococcus sp. PCC7002: SYNPCC7002_A2862Help
Entry
SYNPCC7002_A2862  CDS       T00664                                 

Definition
(GenBank) Conserved hypothetical protein (DUF608)
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
syp  Synechococcus sp. PCC7002
Pathway
syp00511  Other glycan degradation
syp00600  Sphingolipid metabolism
syp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SYNPCC7002_A2862
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SYNPCC7002_A2862
Enzymes [BR:syp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     SYNPCC7002_A2862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N
Motif
Other DBs
NCBI-ProteinID: ACB00830
CyanoBase: SYNPCC7002_A2862
CYORF: SYNPCC7002_A2862
UniProt: B1XNC0
Position
2991804..2994215
Genome map
AA seq 803 aa AA seqDB search
MSLFAEPPVIPDCAWKRPLGLGWDHPYTVRYGSNLDDGPWHGMPLGGFGAGCIGRSPRGD
FNLWHLDAGEHTFRNAGACQFSVFEQPEGEAAQAYAMSTVAPEDGTLDSWQWYPAKKGTY
AALYPRSWYEYQGAFAAELTCEQFSPIIAQNYQETSYPVAVFEWTAHNPTDKPITVSIMM
TWQNMVGWFTKAQKTPEVVLRDDGSPVYEYQSRWGDSTGNLNQWVQDRYRVGCLLNRVRP
HADLSEGEGQLCFATVTNPTLEVFYHNRWNPVGDGRDVWDYFAGNGSLPDIEDETPAAPG
EQIAGAIAVRFTLRPGKTKKIPFFLAWDLPVMEFAPDITYFRRYTDFFGRSGNNVWTMIR
TAMKHSDLWKERIAAWQQPILGRDDLPDWLKMALFNELYLLTQGGSLWTAATENDPVGQF
GVLECLDYCWYESLDVRMYGSFGLTMLWPRLDKAVLEAFARAIPTSDDTQRMIGYNKTMA
TRKVAGATPHDLGAPNEHPWEATNYTAYQDCNLWKDLGSDFVLQVYRDFVMTGAEDTEFL
WSCWGSVLTALDYLKTFDLDGDGIPENGGAPDQTFDDWKLKGISAYCGGLWIAALEAAIA
MAKILQQSPSHFEAHQNQVSAAEFEQAIATYQTWLDQARPLYQDILWNGSYYTLDTGSNS
RVVMADQLCGQYYTQLLSLPDVNPGDRTATTLATIYTACFEKFHGGQFGAANGLNPDGTP
EKENDTHPLEVWTGINFGIAALMIRNGMQTEALRMVEAVVEQVYDNGLQFRTPEAITANG
TFRACHYLRAMGIWAIYDALGAI
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgtttgcggaaccccctgtcatccccgattgtgcctggaaacgtccccttggt
ttgggatgggatcacccctacaccgtccgctatggcagtaatttagacgatggcccctgg
catgggatgcccctcggtgggtttggggcgggttgcatcgggcgatcaccccggggagat
tttaatctgtggcatttagatgcgggggaacacacctttcgcaatgctggtgcttgtcaa
tttagtgtctttgaacagccggagggagaagcagcccaagcctacgcgatgagtaccgtc
gccccagaggatggcaccttggacagttggcaatggtatcccgccaaaaaaggtacctat
gcggccctatacccgcgcagttggtacgaatatcaaggggctttcgccgcagagctgacc
tgtgagcagttttcgccgattattgcccagaattaccaagaaaccagttatcccgtcgct
gtttttgaatggacggcccacaatcccaccgataagccgatcactgtcagtattatgatg
acttggcaaaatatggtggggtggtttaccaaggcccaaaaaacgccggaggtggtgctg
cgggatgacggctccccggtgtacgaataccaatcccgttggggcgatagcactggcaat
ttaaaccaatgggtgcaagaccgctaccgggtgggctgcctgctgaatcgggtgcggccc
catgcggatctcagcgaaggggaaggccaactgtgttttgcgacggtgacgaatccaacc
ctggaagtcttttatcacaaccgttggaacccggtgggggatggccgcgatgtgtgggat
tattttgccgggaatggctccctgccagacattgaagatgaaacaccggctgcgcctggg
gaacaaattgccggggcgatcgccgtccgttttacgctccgacccggcaaaacgaagaaa
atccccttctttctcgcctgggatttgcctgtgatggaatttgcgccggatatcacctat
tttcgccgctacacagacttttttggccggagtgggaataatgtctggacaatgatccgc
acagcgatgaaacatagcgatctctggaaagaacggatcgcggcctggcaacaaccgatc
ctggggcgggatgatctgccggattggctaaaaatggccttatttaatgagctgtacctc
ttaacccaggggggcagcctctggacggcggccacggaaaatgatcccgtcggtcagttt
ggggttttagaatgcctcgactactgctggtacgaaagcctcgatgtgcggatgtatggt
tcttttggtttgacgatgctctggccacgactggataaagcggtgctagaagcctttgcc
cgggcaattcccaccagtgacgatacccaacggatgatcggctacaacaagaccatggcc
acccgcaaagtcgccggggcaacgccccatgatctgggggcaccgaacgaacatccttgg
gaagccaccaattacaccgcctaccaggattgcaacctctggaaagatttggggtcagat
tttgtcctgcaagtgtaccgggattttgtgatgaccggggccgaggatacggaatttctc
tggagctgttggggaagcgtcctcactgccctcgactacctgaagacctttgacctagac
ggcgatggcattcccgaaaatggaggggcaccggatcaaacctttgatgactggaaactg
aaggggatcagtgcctactgtggggggctgtggattgcggccctcgaagcggcgatcgcc
atggcaaaaatcctccaacaaagtcccagtcactttgaagcacaccaaaatcaagtctcc
gcagcagaatttgagcaggcgatcgccacctaccaaacctggctcgaccaggcccggccc
ctttaccaagacatcctctggaacggcagctactacaccctggatacggggagtaattcc
cgcgtggtgatggccgatcaactatgcggtcaatattacacccaactactcagtcttccg
gatgtgaaccccggcgatcgcactgccacaaccctggctaccatttacactgcttgtttt
gaaaaattccatggcggtcaatttggtgcagccaatggcctcaaccccgacggcaccccc
gaaaaagaaaatgacacccaccccctcgaagtgtggacagggattaactttggcattgcc
gccctgatgattcgtaatgggatgcaaaccgaagctctgcggatggtggaagccgtagtg
gaacaggtttatgacaatgggttacagttccgcacccccgaagcgattacagccaatggt
actttccgcgcctgtcactacctacgggccatggggatctgggcgatctacgatgcctta
ggggcaatctaa

DBGET integrated database retrieval system