KEGG   Synechococcus sp. PCC7002: SYNPCC7002_E0035Help
Entry
SYNPCC7002_E0035  CDS       T00664                                 

Definition
type III restriction-modification enzyme, R/helicase subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
syp  Synechococcus sp. PCC7002
Brite
Enzymes [BR:syp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     SYNPCC7002_E0035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
pAQ5:29469..32588
Genome map
AA seq 1039 aa AA seqDB search
MSRSMQEVVIENPIINSPFEEPQLHFRFDENGLTNEIVEKRRISHYFIPIAKPKKKSKQL
ELEYGGHWTSDRIEENEFINYIREKVGIWRKGGYRGAVGITAITRRLLEHWKNPDRERRL
FFCQLEALETIIYITEVAKRSGDTYIENMLQKYKEEAGSLLYRMALKMATGSGKTVVMSM
LIAWHTLNKVANPQNRLFSDAFLIVAPGITIRDRLRVLMPNDPENYYRRLDLVPQDLMGD
LEKAKIVITNYHAFMLKEKESAAKLTKSLLIQGKEQSPFTETPDEMVRRVCRGLGNKKNI
IVLNDEAHHCYNHKPDGDEETYKGDDRKEAKKNDENARVWSSGLEAVQNKLGIKAVYDLS
ATPFYLKGSGYREGTLFPWVVSDFSLIDAIESGIVKVPRVPVSDDSMKGELPTYRNIWTL
IRDHLPKKGRSNKDSDVSPEPKLPKELEGALISLYANYEKSYRLWEQNTEAIPGGSAKRH
AKGLTPPVFIVVCNNTSVSKMVYDWIVGWDTGKRLPNDDPVLAPGKLPLFSNVENGRWLA
RPNTILVDSEQLESGEAMTTEFKQIASAEIDDFKEEYRRRYPGSDPDKISDEELLREVMN
TVGKAGKLGEQIRCVVSVSMLTEGWDANTVTHILGVRAFGTQLLCEQVVGRALRRISYAV
NEENRFEPEYAEVYGVPFSFIPCAGGGKTPKPGVLPTRVRSLPERSHARITFPRLLGYRY
EMTRQELKPNFENLGCRYTLSTENLPTMTVNAPIIGQSSIHTIDDLKSRRVQEVAFLLAK
LTLERYFRQDGDRLTEKPEEHRFDPDVQSWLFPQVLQISKDWLGECLIQKSHTFPQMLLL
TEFAYDASDCIYQAIAAGESEKFLKPILRPYETIGSTDGVDFDTSRPVYVSDPEKCHISH
VVADTDSWEQKMAQVLESMAEVVCYVKNQGLGFFIPYTMAGQSKNYMPDFIARVDDGHGE
DDLLNLIVEVSGEARRDKAIKVQTARNFWLPAVNGHGGLGRWEFINITDPWDAENTIRAA
LRTKDFNQFEGHLLKYQGE
NT seq 3120 nt NT seq  +upstreamnt  +downstreamnt
atgtctagatctatgcaggaagtagtcattgaaaatccgattatcaactctccatttgaa
gagccgcagcttcatttcaggtttgacgaaaatggactaactaacgaaattgtcgaaaaa
cgtcgaattagtcactatttcatccccatcgccaagccaaagaagaagagcaagcagttg
gagttggaatatggtggacattggacaagcgatcgcattgaagagaatgagttcattaac
tacatccgcgagaaagtagggatttggcggaagggtggttatcgtggtgctgtaggaatt
acagcgattacccgtcgtctgttggaacattggaaaaatcctgatcgggaaagacgttta
tttttctgtcagcttgaagcgttagaaacgatcatctacatcactgaagtggcaaaacgc
tccggtgatacctacatcgaaaatatgcttcagaagtacaaggaagaagctggatcgttg
ctctaccggatggctctgaagatggcaacgggtagcggtaaaacggtggtgatgtcgatg
ctgattgcttggcataccctcaataaggtggcaaatcctcaaaaccgtttatttagtgat
gcgtttttgattgtggctccaggcattacgatccgcgatcgcctacgggtgttgatgccg
aatgaccctgagaactattaccgcagactggatttagtaccccaagatttaatgggggac
ttggagaaagccaagatagtcatcacgaactatcacgctttcatgttgaaggaaaaggag
agtgcggcgaagttaacgaaaagccttttgattcaagggaaagaacagagtcctttcaca
gaaaccccagatgagatggtacgtcgggtttgtcggggtttggggaataagaaaaatatt
attgtgctgaatgatgaggcgcaccactgctataaccacaagccagatggagatgaggaa
acctacaaaggggatgatcgaaaggaagcaaaaaagaatgacgagaatgcgagggtttgg
agttctgggttagaggcagttcaaaataaactgggcattaaagcagtttatgacctatcg
gcaacgcctttctatctcaagggttctggctatcgggaaggaacgttatttccttgggtg
gtctcggatttttccctcattgatgcgattgaatcgggcattgtcaaagtcccccgtgtg
cctgtctctgatgacagcatgaagggtgaactacccacctatcggaatatctggactttg
attcgggatcatctaccgaagaaaggacggagcaataaagatagtgatgtttctccagaa
ccaaagttaccgaaggaattggaaggggctttaatcagtctctatgccaactatgaaaaa
tcctatcggctttgggaacagaatacggaggcgatcccagggggatccgcgaagcggcac
gccaaggggttgacgccacctgtgtttattgtggtttgcaataacaccagtgtttcaaag
atggtctatgactggattgtaggttgggatacgggtaaacgtttgccgaatgatgatccg
gttttagcaccagggaaattaccgctgtttagtaatgtcgagaatggtcgctggcttgcg
agacccaacacgattctggtggatagtgagcagttggaatctggggaggcgatgaccacc
gagtttaagcagattgcctcggctgagattgatgattttaaagaggaatatcggcgacgg
tatcccggttcagacccggacaaaatcagtgatgaggaattactcagggaagtgatgaac
accgtgggtaaggctggcaaactgggtgagcaaattcgttgtgtggtctcagtttccatg
cttacggaaggttgggacgcgaatactgtgacccatatccttggggtgagagcctttggg
acgcagttactttgtgagcaggtggtgggtcgggcattacggcgcattagttatgcggtc
aatgaggagaaccgctttgaaccggagtatgctgaggtctatggggttccgttttcattt
attccctgtgcgggaggtggtaaaacgccgaagccgggagtgttgcccacgagggttagg
tcattgccagaacggagccatgccagaattacattccctcggttgttaggctatcggtac
gaaatgactcgccaggagttaaagcctaattttgaaaatctgggttgtcgatatacactc
tccactgaaaatctaccaacgatgacggttaatgcgccgattattgggcagtccagtatc
cacacgattgatgatctcaaatctcgtcgggtgcaggaggtggcttttttgttggcgaag
ttaaccctagagcgatacttccggcaggatggcgatcgcctaacggagaaaccggaggaa
catcgttttgacccggatgtgcagtcgtggttatttccgcaggtgttgcaaatctcgaag
gattggttaggggaatgtctcatccagaaatctcacaccttcccccaaatgcttctgtta
actgagtttgcttatgatgccagtgattgtatttatcaggcgatcgccgctggggagtcg
gagaaattcttaaaaccgattttgcgtccctatgaaacgattggctcaacggatggggtt
gattttgataccagtcgcccggtctatgtgagtgaccctgagaaatgccatatctcccac
gtggtagcagatacggacagttgggaacagaagatggcgcaggtgttagagtcgatggct
gaggtggtctgttatgtgaaaaaccaggggttaggcttctttattccctacacgatggca
ggtcaatcgaaaaactatatgccggattttatcgccagagttgatgatggtcatggggaa
gatgatctcctaaatttgatcgtggaggtttccggggaagcacgacgggataaggcgatt
aaggtacagaccgctcgaaatttctggttgcctgcggtgaatggtcatggtgggttgggt
cggtgggagtttatcaatatcactgacccgtgggatgctgaaaataccattcgggcagca
ctccgaacgaaagatttcaatcagtttgaaggtcatttattgaagtatcaaggggagtaa

DBGET integrated database retrieval system