KEGG   Synechococcus sp. PCC7002: SYNPCC7002_G0127Help
Entry
SYNPCC7002_G0127  CDS       T00664                                 

Gene name
hemB-II
Definition
(RefSeq) delta-aminolevulinic acid dehydratase
  KO
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SYNPCC7002_G0127 (hemB-II)
Enzymes [BR:syp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SYNPCC7002_G0127 (hemB-II)
Exosome [BR:syp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SYNPCC7002_G0127 (hemB-II)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
pAQ7:146775..147860
Genome map
AA seq 361 aa AA seqDB search
MSIPPPRPESPLATVVNISTKATTPAKTTDATTPAEVAIYRPRRLRRTTALRRMVRETAL
TVNDFIYPLFVMEGEGQKAEIPSMPGCFRYSLDLLLAEVATAYDLSIGAIALFPLIPDYQ
KDNIGTESHNPAGLIPRTVRAIKEALPDMVVITDIALDPYSSEGHDGIVQDGEILNDETV
AVLVKQALMHAEAGADFVAPSDMMDGRVGAIRRALDAAGWINVGILAYSAKYASAYYGPF
RDALDSAPKFGDKKTYQMDPANGQEALKEVELDILEGADIVMVKPALAYLDIIYRIKQRT
NLPVAAYNVSGEYAMVKAAAKRGWLDEQTVVLETLTSMKRAGADLILTYFAKEAAIALQQ
M
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatacccccacctcgcccagagtctcctttagccactgttgtaaatatttctact
aaagccacaacccctgctaaaaccactgatgctacgactcctgctgaagtagcaatatat
cggccccggcgactacgacggactactgctttacgccgcatggtgcgtgaaacggctttg
acggtgaatgattttatttatcctctatttgtcatggagggtgaaggacaaaaagcggaa
atcccttcgatgcctggctgttttcgttattctttggatttgctattagctgaagtggcg
acagcttatgacctcagcattggggcgatcgccctttttccgttgattcctgattaccaa
aaagacaatataggtaccgaaagccataatcctgccgggttgattcctcgaactgtacgg
gcgattaaagaagctctgcccgacatggttgtaatcacagatatcgccctcgatccctat
agcagcgagggccatgacggcattgtccaagatggagaaattctcaatgatgagacagtt
gctgtcctggtcaaacaagccctcatgcacgcagaggcaggggctgattttgtggcacca
tcggacatgatggatggtcgcgtgggtgcaattcgccgcgccctcgatgcagcgggctgg
attaatgtggggattcttgcctattccgctaaatatgcatctgcttactatgggccattt
cgagatgccttggattcggcccctaagtttggtgacaaaaaaacctaccaaatggacccg
gccaatggtcaagaggccctcaaagaagtggaattagacattctcgaaggggctgacatc
gtgatggttaaaccggccttagcctatctggatattatctatcgcatcaaacaacggaca
aatttacccgtcgccgcctacaacgtcagtggggaatatgccatggtcaaagcagcggcc
aaacggggttggttagatgaacaaacagtcgtgctagaaaccttgaccagcatgaaacgg
gcaggggctgacttgattttgacctatttcgctaaggaagcggctatagctttacagcaa
atgtaa

DBGET integrated database retrieval system