KEGG   Synechococcus sp. PCC7002: SYNPCC7002_G0127Help
Entry
SYNPCC7002_G0127  CDS       T00664                                 

Gene name
hemB-II
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
syp  Synechococcus sp. PCC7002
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:syp00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
CyanoBase: 
UniProt: 
Position
pAQ7:146775..147860
Genome map
AA seq 361 aa AA seqDB search
MSIPPPRPESPLATVVNISTKATTPAKTTDATTPAEVAIYRPRRLRRTTALRRMVRETAL
TVNDFIYPLFVMEGEGQKAEIPSMPGCFRYSLDLLLAEVATAYDLSIGAIALFPLIPDYQ
KDNIGTESHNPAGLIPRTVRAIKEALPDMVVITDIALDPYSSEGHDGIVQDGEILNDETV
AVLVKQALMHAEAGADFVAPSDMMDGRVGAIRRALDAAGWINVGILAYSAKYASAYYGPF
RDALDSAPKFGDKKTYQMDPANGQEALKEVELDILEGADIVMVKPALAYLDIIYRIKQRT
NLPVAAYNVSGEYAMVKAAAKRGWLDEQTVVLETLTSMKRAGADLILTYFAKEAAIALQQ
M
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatacccccacctcgcccagagtctcctttagccactgttgtaaatatttctact
aaagccacaacccctgctaaaaccactgatgctacgactcctgctgaagtagcaatatat
cggccccggcgactacgacggactactgctttacgccgcatggtgcgtgaaacggctttg
acggtgaatgattttatttatcctctatttgtcatggagggtgaaggacaaaaagcggaa
atcccttcgatgcctggctgttttcgttattctttggatttgctattagctgaagtggcg
acagcttatgacctcagcattggggcgatcgccctttttccgttgattcctgattaccaa
aaagacaatataggtaccgaaagccataatcctgccgggttgattcctcgaactgtacgg
gcgattaaagaagctctgcccgacatggttgtaatcacagatatcgccctcgatccctat
agcagcgagggccatgacggcattgtccaagatggagaaattctcaatgatgagacagtt
gctgtcctggtcaaacaagccctcatgcacgcagaggcaggggctgattttgtggcacca
tcggacatgatggatggtcgcgtgggtgcaattcgccgcgccctcgatgcagcgggctgg
attaatgtggggattcttgcctattccgctaaatatgcatctgcttactatgggccattt
cgagatgccttggattcggcccctaagtttggtgacaaaaaaacctaccaaatggacccg
gccaatggtcaagaggccctcaaagaagtggaattagacattctcgaaggggctgacatc
gtgatggttaaaccggccttagcctatctggatattatctatcgcatcaaacaacggaca
aatttacccgtcgccgcctacaacgtcagtggggaatatgccatggtcaaagcagcggcc
aaacggggttggttagatgaacaaacagtcgtgctagaaaccttgaccagcatgaaacgg
gcaggggctgacttgattttgacctatttcgctaaggaagcggctatagctttacagcaa
atgtaa

DBGET integrated database retrieval system